EMLSAG00000008902, EMLSAG00000008902-691668 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000008902
Unique NameEMLSAG00000008902-691668
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: female reproduction, no eggstrings
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
AL F338 FTZ-F1 female
  1. PreAdult2
  2. Adult
No eggstrings
female reproduction, no eggstrings
28.08.2017 - 10:00
06.10.2017 - 10:00
AL F339 FTZ-F1 female
  1. PreAdult2
  2. Adult
No eggstrings
female reproduction, no eggstrings
28.08.2017 - 10:00
06.10.2017 (All day)
Homology
BLAST of EMLSAG00000008902 vs. GO
Match: - (symbol:ftz-f1 "ftz transcription factor 1" species:7227 "Drosophila melanogaster" [GO:0005634 "nucleus" evidence=ISS;NAS;IDA] [GO:0003677 "DNA binding" evidence=NAS;IDA] [GO:0001077 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription" evidence=IDA] [GO:0007365 "periodic partitioning" evidence=IMP] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=ISS;NAS] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS] [GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=IDA] [GO:0035071 "salivary gland cell autophagic cell death" evidence=NAS] [GO:0035075 "response to ecdysone" evidence=TAS] [GO:0009725 "response to hormone" evidence=TAS] [GO:0008219 "cell death" evidence=TAS] [GO:0040034 "regulation of development, heterochronic" evidence=TAS] [GO:0007552 "metamorphosis" evidence=IMP;TAS] [GO:0003712 "transcription cofactor activity" evidence=NAS] [GO:0006355 "regulation of transcription, DNA-templated" evidence=IMP;NAS] [GO:0005737 "cytoplasm" evidence=NAS] [GO:0002165 "instar larval or pupal development" evidence=IMP] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0043401 "steroid hormone mediated signaling pathway" evidence=IEA] [GO:0042048 "olfactory behavior" evidence=IMP] [GO:0016319 "mushroom body development" evidence=IMP] [GO:0035074 "pupation" evidence=IMP] [GO:0007480 "imaginal disc-derived leg morphogenesis" evidence=IMP] [GO:0008134 "transcription factor binding" evidence=IPI] [GO:0046982 "protein heterodimerization activity" evidence=IPI] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP] [GO:0035626 "juvenile hormone mediated signaling pathway" evidence=IMP] [GO:0000976 "transcription regulatory region sequence-specific DNA binding" evidence=IDA] [GO:0055088 "lipid homeostasis" evidence=IMP] [GO:0035073 "pupariation" evidence=IMP] [GO:0048813 "dendrite morphogenesis" evidence=IMP] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0005634 GO:GO:0005737 EMBL:AE014296 GO:GO:0008219 GO:GO:0004879 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0055088 GO:GO:0001077 GO:GO:0048813 GO:GO:0016319 GO:GO:0042048 GO:GO:0035073 GO:GO:0040034 GO:GO:0000976 GO:GO:0007480 GO:GO:0035074 GO:GO:0035075 GO:GO:0035626 eggNOG:NOG240365 GeneTree:ENSGT00670000097927 KO:K08705 EMBL:M63711 EMBL:M98397 EMBL:BT058016 EMBL:AY051845 PIR:A47303 PIR:T13733 RefSeq:NP_001246824.1 RefSeq:NP_524143.2 RefSeq:NP_730359.1 UniGene:Dm.995 PDB:2XHS PDBsum:2XHS ProteinModelPortal:P33244 SMR:P33244 BioGrid:65326 IntAct:P33244 MINT:MINT-156933 PaxDb:P33244 EnsemblMetazoa:FBtr0075086 GeneID:40045 KEGG:dme:Dmel_CG4059 CTD:40045 FlyBase:FBgn0001078 InParanoid:P33244 OMA:SKHCAGS OrthoDB:EOG7BS4B9 PhylomeDB:P33244 SignaLink:P33244 GenomeRNAi:40045 NextBio:816714 Bgee:P33244 GO:GO:0007365 Uniprot:P33244)

HSP 1 Score: 255.758 bits (652), Expect = 8.451e-73
Identity = 130/200 (65.00%), Postives = 144/200 (72.00%), Query Frame = 0
Query:  177 DSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGV--SMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHL 374
            D K   EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA+RSC IDKTQRKRCPYCRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQV+RQRQ+    +  SMGP  +  T  +     +Y              P+MN                 IKQEIQIPQV+S+T SPD+SPSP+ +
Sbjct:  499 DFKHLFEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQVMRQRQLALQALRNSMGP-DIKPTPISPGYQQAY--------------PNMN-----------------IKQEIQIPQVSSLTQSPDSSPSPIAI 666          

HSP 2 Score: 113.235 bits (282), Expect = 7.249e-25
Identity = 44/68 (64.71%), Postives = 61/68 (89.71%), Query Frame = 0
Query:  428 KMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            ++  +IREF+ S+DDREWQ++L+ LLQ Q++NQVEVDLFEL+CKVLD NLF+QVDWARN+ +F++LK+
Sbjct:  792 RVSPMIREFVQSIDDREWQTQLFALLQKQTYNQVEVDLFELMCKVLDQNLFSQVDWARNTVFFKDLKV 859          
BLAST of EMLSAG00000008902 vs. GO
Match: - (symbol:NR5A2 "Nuclear receptor subfamily 5 group A member 2" species:9606 "Homo sapiens" [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0006351 "transcription, DNA-templated" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 GO:GO:0005634 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0003700 GO:GO:0006351 GO:GO:0043401 HGNC:HGNC:7984 EMBL:AC096633 ProteinModelPortal:H0Y328 PRIDE:H0Y328 Ensembl:ENST00000367357 NextBio:35519229 Bgee:H0Y328 Uniprot:H0Y328)

HSP 1 Score: 231.491 bits (589), Expect = 2.512e-68
Identity = 139/324 (42.90%), Postives = 182/324 (56.17%), Query Frame = 0
Query:  182 MEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQ---VLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASG-GMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNP---IIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFL-ASLDDREWQSELYKLLQSQSFNQV---EVDLFELLCKVLDHNLFAQVDWARNSYYFRELK 494
            +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN K YTC+ +++C IDKTQRKRCPYCRFQKCL VGMKLEAVR DRMRGGRNKFGPMYKRDRA K Q   ++R   +    +S    +M +  T +S+  +    + G  +N    PP+    + + SP +                         TSP  + +P     P G+  G  T G  P   I ++  DP       I     + D         +P +I E L    D+ + Q+++   LQ +  N+    ++  F L+CK+ D  LF+ V+WAR+S +FRELK
Sbjct:    3 LEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPT----DYDRSPFV-------------------------TSPISMTMP-----PHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYS-YMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELK 291          
BLAST of EMLSAG00000008902 vs. GO
Match: - (symbol:NR5A2 "cDNA, FLJ79412, highly similar to Orphan nuclear receptor NR5A2" species:9606 "Homo sapiens" [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0006351 "transcription, DNA-templated" evidence=IEA] [GO:0008206 "bile acid metabolic process" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0042127 "regulation of cell proliferation" evidence=IEA] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0005634 GO:GO:0008206 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 GO:GO:0003700 GO:GO:0006351 GO:GO:0042632 GO:GO:0042127 InterPro:IPR016355 PIRSF:PIRSF002530 CTD:2494 HOGENOM:HOG000063718 HOVERGEN:HBG106677 KO:K08027 RefSeq:NP_001263393.1 UniGene:Hs.33446 GeneID:2494 KEGG:hsa:2494 HGNC:HGNC:7984 EMBL:AC096633 EMBL:AK304365 EMBL:AK316513 RefSeq:XP_005245119.1 ProteinModelPortal:B4E2P3 SMR:B4E2P3 Ensembl:ENST00000544748 NextBio:35477332 ArrayExpress:B4E2P3 Uniprot:B4E2P3)

HSP 1 Score: 233.802 bits (595), Expect = 3.089e-68
Identity = 139/327 (42.51%), Postives = 184/327 (56.27%), Query Frame = 0
Query:  180 DGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQ---VLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGG-MNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNP---IIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASL-DDREWQSELYKLLQSQSFNQV---EVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            + +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN K YTC+ +++C IDKTQRKRCPYCRFQKCL VGMKLEAVR DRMRGGRNKFGPMYKRDRA K Q   ++R   +    +S    +M +  T +S+  +    + G  +N    PP+    + + SP +                         TSP  + +P     P G+  G  T G  P   I ++  DP       I     + D         +P +I E L    D+ + Q+++   LQ +  N+    ++  F L+CK+ D  LF+ V+WAR+S +FRELK+
Sbjct:    8 EDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPT----DYDRSPFV-------------------------TSPISMTMP-----PHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYS-YMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKV 299          
BLAST of EMLSAG00000008902 vs. GO
Match: - (symbol:NR5A2 "Nuclear receptor subfamily 5 group A member 2" species:9031 "Gallus gallus" [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0005543 "phospholipid binding" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0006351 "transcription, DNA-templated" evidence=IEA] [GO:0008206 "bile acid metabolic process" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0042127 "regulation of cell proliferation" evidence=IEA] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] [GO:0044212 "transcription regulatory region DNA binding" evidence=IEA] [GO:0045070 "positive regulation of viral genome replication" evidence=IEA] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0005634 GO:GO:0005737 GO:GO:0045893 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0003700 GO:GO:0006351 GO:GO:0005543 GO:GO:0044212 GO:GO:0045070 GeneTree:ENSGT00670000097927 OrthoDB:EOG7BS4B9 InterPro:IPR016355 PIRSF:PIRSF002530 TreeFam:TF350737 EMBL:AADN03005494 EMBL:AADN03005551 EMBL:AADN03005518 Ensembl:ENSGALT00000003418 ArrayExpress:F1NVB5 Uniprot:F1NVB5)

HSP 1 Score: 235.343 bits (599), Expect = 4.166e-68
Identity = 142/331 (42.90%), Postives = 185/331 (55.89%), Query Frame = 0
Query:  180 DGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNN------TXTTTSSSASYGGGASGG--MNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNP---IIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASL-DDREWQSELYKLLQSQSFNQV---EVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            + +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN K YTC+ +++C IDKTQRKRCPYCRFQKCL VGMKLEAVR DRMRGGRNKFGPMYKRDRA K    +Q++ +     +   +M        T  T SS+      AS G  +N T  PP+    + + SP +                         TSP  + +P     P G+  G  T G  P   I ++  DP       I     + D         +P +I E L    D+ + Q+++   LQ +  N+    +++ F L+CK+ D  LF+ V+WAR+S +FRELK+
Sbjct:   80 EDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALK----QQKKALIRANGLKLEAMTQVIQAMPTDLTISSAIQNIHSASKGLPLNHTALPPT----DYDRSPFV-------------------------TSPISMTMP-----PHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYS-YMDGYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLNTFGLMCKMADQTLFSIVEWARSSIFFRELKV 371          
BLAST of EMLSAG00000008902 vs. GO
Match: - (symbol:Nr5a2 "nuclear receptor subfamily 5, group A, member 2" species:10090 "Mus musculus" [GO:0003677 "DNA binding" evidence=ISO;IDA] [GO:0003690 "double-stranded DNA binding" evidence=ISO] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISO] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=ISO] [GO:0005543 "phospholipid binding" evidence=ISO] [GO:0005634 "nucleus" evidence=ISO;IDA] [GO:0005737 "cytoplasm" evidence=ISO] [GO:0006351 "transcription, DNA-templated" evidence=IEA] [GO:0006355 "regulation of transcription, DNA-templated" evidence=ISO] [GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=ISO] [GO:0006366 "transcription from RNA polymerase II promoter" evidence=ISO] [GO:0008206 "bile acid metabolic process" evidence=IMP] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0008289 "lipid binding" evidence=IEA] [GO:0030522 "intracellular receptor signaling pathway" evidence=ISO] [GO:0042127 "regulation of cell proliferation" evidence=IGI] [GO:0042632 "cholesterol homeostasis" evidence=IMP] [GO:0043401 "steroid hormone mediated signaling pathway" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=ISO] [GO:0044212 "transcription regulatory region DNA binding" evidence=ISO] [GO:0045070 "positive regulation of viral genome replication" evidence=ISO] [GO:0045893 "positive regulation of transcription, DNA-templated" evidence=ISO] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP] [GO:0046872 "metal ion binding" evidence=IEA] Reactome:REACT_13641 InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 MGI:MGI:1346834 GO:GO:0005829 GO:GO:0005634 GO:GO:0008206 GO:GO:0003677 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 GO:GO:0003700 GO:GO:0006351 GO:GO:0005543 GO:GO:0044212 GO:GO:0042632 GO:GO:0042127 Reactome:REACT_188576 GO:GO:0031018 GO:GO:0045070 eggNOG:NOG240365 GeneTree:ENSGT00670000097927 OrthoDB:EOG7BS4B9 InterPro:IPR016355 PIRSF:PIRSF002530 PDB:3F5C PDBsum:3F5C PDB:1ZH7 PDBsum:1ZH7 CTD:2494 HOGENOM:HOG000063718 HOVERGEN:HBG106677 KO:K08027 OMA:NTFGLMC TreeFam:TF350737 EMBL:M81385 EMBL:BC137845 PIR:S27874 RefSeq:NP_109601.1 UniGene:Mm.16794 PDB:1PK5 PDBsum:1PK5 ProteinModelPortal:P45448 SMR:P45448 BioGrid:204976 PhosphoSite:P45448 PaxDb:P45448 PRIDE:P45448 Ensembl:ENSMUST00000027649 GeneID:26424 KEGG:mmu:26424 UCSC:uc007cva.2 InParanoid:P45448 EvolutionaryTrace:P45448 NextBio:304453 PRO:PR:P45448 ArrayExpress:P45448 Bgee:P45448 CleanEx:MM_NR5A2 Genevestigator:P45448 Uniprot:P45448)

HSP 1 Score: 234.958 bits (598), Expect = 7.700e-68
Identity = 136/320 (42.50%), Postives = 181/320 (56.56%), Query Frame = 0
Query:  180 DGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNPIIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASL-DDREWQSELYKLLQSQSFN---QVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            + +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN+K YTC+ +++C IDKTQRKRCPYCRF+KC+DVGMKLEAVR DRMRGGRNKFGPMYKRDRA K    +Q++ +     +   +M+                         P  + +   N   +  G P++H+     +P      S   TSP  + +P   S  G  P G     S  I ++  DP       +         Q+N     +P +I E L    D+ + Q+++   LQ +  N   Q ++  F LLCK+ D  LF+ V+WAR+S +FRELK+
Sbjct:  101 EDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNQKRYTCIENQNCQIDKTQRKRCPYCRFKKCIDVGMKLEAVRADRMRGGRNKFGPMYKRDRALK----QQKKALIRANGLKLEAMSQVIQAM-------------------PSDLTSAIQNIHSASKGLPLSHVA----LPPTDYDRSPFVTSPISMTMPPHSSLHGYQPYGHFP--SRAIKSEYPDPYSSSPESMMGYSYMDGYQTN-SPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQSNRNRQEKLSAFGLLCKMADQTLFSIVEWARSSIFFRELKV 390          
BLAST of EMLSAG00000008902 vs. GO
Match: - (symbol:NR5A2 "Nuclear receptor subfamily 5 group A member 2" species:9606 "Homo sapiens" [GO:0003677 "DNA binding" evidence=IDA] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IDA] [GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=TAS] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=TAS] [GO:0005515 "protein binding" evidence=IPI] [GO:0005543 "phospholipid binding" evidence=IDA] [GO:0005634 "nucleus" evidence=IDA] [GO:0005654 "nucleoplasm" evidence=TAS] [GO:0005737 "cytoplasm" evidence=IDA] [GO:0006355 "regulation of transcription, DNA-templated" evidence=IDA;TAS] [GO:0006367 "transcription initiation from RNA polymerase II promoter" evidence=TAS] [GO:0008206 "bile acid metabolic process" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0009790 "embryo development" evidence=TAS] [GO:0010467 "gene expression" evidence=TAS] [GO:0030522 "intracellular receptor signaling pathway" evidence=TAS] [GO:0031018 "endocrine pancreas development" evidence=TAS] [GO:0042127 "regulation of cell proliferation" evidence=IEA] [GO:0042592 "homeostatic process" evidence=NAS] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IDA] [GO:0044212 "transcription regulatory region DNA binding" evidence=IDA] [GO:0045070 "positive regulation of viral genome replication" evidence=IDA] [GO:0045893 "positive regulation of transcription, DNA-templated" evidence=IDA;TAS] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA] Reactome:REACT_71 InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0005737 Reactome:REACT_111045 GO:GO:0045893 GO:GO:0005654 GO:GO:0008206 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 EMBL:CH471067 GO:GO:0005543 GO:GO:0044212 GO:GO:0042632 GO:GO:0003705 GO:GO:0042127 GO:GO:0009790 GO:GO:0031018 GO:GO:0006367 GO:GO:0042592 GO:GO:0045070 PDB:3TX7 PDBsum:3TX7 eggNOG:NOG240365 OrthoDB:EOG7BS4B9 PDB:1YOK PDB:1ZDU PDB:3PLZ PDB:4DOS PDBsum:1YOK PDBsum:1ZDU PDBsum:3PLZ PDBsum:4DOS InterPro:IPR016355 PIRSF:PIRSF002530 PDB:1YUC PDB:4DOR PDBsum:1YUC PDBsum:4DOR CTD:2494 HOGENOM:HOG000063718 HOVERGEN:HBG106677 KO:K08027 EMBL:U80251 EMBL:AF146343 EMBL:AF124247 EMBL:AF190464 EMBL:BC118571 EMBL:BC118652 EMBL:U93553 RefSeq:NP_001263393.1 RefSeq:NP_003813.1 RefSeq:NP_995582.1 UniGene:Hs.33446 PDB:2A66 PDB:4IS8 PDBsum:2A66 PDBsum:4IS8 ProteinModelPortal:O00482 SMR:O00482 BioGrid:108772 DIP:DIP-37952N IntAct:O00482 MINT:MINT-2997724 STRING:9606.ENSP00000356331 BindingDB:O00482 ChEMBL:CHEMBL3544 PhosphoSite:O00482 PaxDb:O00482 PRIDE:O00482 Ensembl:ENST00000236914 Ensembl:ENST00000367362 GeneID:2494 KEGG:hsa:2494 UCSC:uc001gvb.4 GeneCards:GC01P199996 HGNC:HGNC:7984 HPA:HPA005455 HPA:HPA017067 MIM:604453 neXtProt:NX_O00482 PharmGKB:PA31765 InParanoid:O00482 OMA:NTFGLMC PhylomeDB:O00482 TreeFam:TF350737 SignaLink:O00482 EvolutionaryTrace:O00482 GeneWiki:Liver_receptor_homolog-1 GenomeRNAi:2494 NextBio:9851 PRO:PR:O00482 ArrayExpress:O00482 Bgee:O00482 CleanEx:HS_NR5A2 Genevestigator:O00482 Uniprot:O00482)

HSP 1 Score: 233.802 bits (595), Expect = 1.713e-67
Identity = 139/327 (42.51%), Postives = 184/327 (56.27%), Query Frame = 0
Query:  180 DGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQ---VLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGG-MNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNP---IIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASL-DDREWQSELYKLLQSQSFNQV---EVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            + +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN K YTC+ +++C IDKTQRKRCPYCRFQKCL VGMKLEAVR DRMRGGRNKFGPMYKRDRA K Q   ++R   +    +S    +M +  T +S+  +    + G  +N    PP+    + + SP +                         TSP  + +P     P G+  G  T G  P   I ++  DP       I     + D         +P +I E L    D+ + Q+++   LQ +  N+    ++  F L+CK+ D  LF+ V+WAR+S +FRELK+
Sbjct:   80 EDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPT----DYDRSPFV-------------------------TSPISMTMP-----PHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYS-YMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKV 371          
BLAST of EMLSAG00000008902 vs. GO
Match: - (symbol:NR5A2 "Nuclear receptor subfamily 5 group A member 2" species:9031 "Gallus gallus" [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0006351 "transcription, DNA-templated" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0005634 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0003700 GO:GO:0006351 eggNOG:NOG240365 InterPro:IPR016355 PIRSF:PIRSF002530 EMBL:AB002403 RefSeq:NP_990409.1 UniGene:Gga.572 ProteinModelPortal:O42101 SMR:O42101 STRING:9031.ENSGALP00000003413 PaxDb:O42101 PRIDE:O42101 GeneID:395961 KEGG:gga:395961 CTD:2494 HOGENOM:HOG000063718 HOVERGEN:HBG106677 InParanoid:O42101 KO:K08027 NextBio:20816026 PRO:PR:O42101 Uniprot:O42101)

HSP 1 Score: 231.876 bits (590), Expect = 3.270e-67
Identity = 141/331 (42.60%), Postives = 184/331 (55.59%), Query Frame = 0
Query:  180 DGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNN------TXTTTSSSASYGGGASGG--MNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNP---IIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASL-DDREWQSELYKLLQSQSFNQ---VEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            + +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN K YTC+ +++C IDKTQRKRCPYCRFQKCL VGMKLEAVR DRMRGGRNKFGPMYKRDRA K    +Q++ +     +   +M        T  T SS+      AS G  +N T  PP+    + + SP +                         TSP  + +P     P G+  G  T G  P   I ++  DP       I     + D         +P +I E      D+ + Q+++   LQ +  N+    +++ F L+CK+ D  LF+ V+WAR+S +FRELK+
Sbjct:   40 EDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALK----QQKKALIRANGLKLEAMTQVIQAMPTDLTISSAIQNIHSASKGLPLNHTALPPT----DYDRSPFV-------------------------TSPISMTMP-----PHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYS-YMDGYQTSSPASIPHLILELQKCEPDEPQVQAKIMAYLQQEQANRSKHEKLNTFGLMCKMADQTLFSIVEWARSSIFFRELKV 331          
BLAST of EMLSAG00000008902 vs. GO
Match: - (symbol:NR5A2 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0005543 "phospholipid binding" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0006351 "transcription, DNA-templated" evidence=IEA] [GO:0008206 "bile acid metabolic process" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0042127 "regulation of cell proliferation" evidence=IEA] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] [GO:0044212 "transcription regulatory region DNA binding" evidence=IEA] [GO:0045070 "positive regulation of viral genome replication" evidence=IEA] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 GO:GO:0005634 GO:GO:0005737 GO:GO:0008206 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0045944 GO:GO:0003700 GO:GO:0006351 GO:GO:0005543 GO:GO:0044212 GO:GO:0042632 GO:GO:0042127 GO:GO:0045070 GeneTree:ENSGT00670000097927 OrthoDB:EOG7BS4B9 InterPro:IPR016355 PIRSF:PIRSF002530 KO:K08027 OMA:NTFGLMC TreeFam:TF350737 EMBL:AAEX03005037 RefSeq:XP_005622333.1 Ensembl:ENSCAFT00000017785 GeneID:490252 Uniprot:F1PXN4)

HSP 1 Score: 231.106 bits (588), Expect = 1.068e-66
Identity = 142/350 (40.57%), Postives = 190/350 (54.29%), Query Frame = 0
Query:  169 VVGQSDQPDSK------------DGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQ---VLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGG-MNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNP---IIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASL-DDREWQSELYKLLQSQSFNQV---EVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            V G++D P +             + +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN K YTC+ +++C IDKTQRKRCPYCRFQKCL VGMKLEAVR DRMRGGRNKFGPMYKRDRA K Q   ++R   +    +S    +M +  T +S+  +    + G  +N    PP+    + + SP +                         TSP  + +P     P G+  G  T    P   I ++  DP       I     + D         +P +I E L    D+ + Q+++   LQ +  N+    ++  F L+CK+ D  LF+ V+WAR+S +FRELK+
Sbjct:   35 VAGRADLPQAAVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSELTISSAIQNIHSASKGLPLNHAALPPT----DYDRSPFV-------------------------TSPISMTMP-----PLGSLQGYQTYSHFPSRAIKSEYPDPYTSSPESIMGYS-YMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKV 349          
BLAST of EMLSAG00000008902 vs. GO
Match: - (symbol:Nr5a2 "Nuclear receptor subfamily 5 group A member 2" species:10116 "Rattus norvegicus" [GO:0003677 "DNA binding" evidence=ISS] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0006355 "regulation of transcription, DNA-templated" evidence=ISS] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0008289 "lipid binding" evidence=IEA] [GO:0030522 "intracellular receptor signaling pathway" evidence=IDA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 RGD:68353 GO:GO:0005634 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0008289 GO:GO:0003690 eggNOG:NOG240365 InterPro:IPR016355 PIRSF:PIRSF002530 CTD:2494 HOGENOM:HOG000063718 HOVERGEN:HBG106677 KO:K08027 TreeFam:TF350737 EMBL:AB012960 EMBL:AB012961 RefSeq:NP_068510.1 RefSeq:XP_006249990.1 UniGene:Rn.42941 ProteinModelPortal:Q9QWM1 SMR:Q9QWM1 PhosphoSite:Q9QWM1 PaxDb:Q9QWM1 GeneID:60349 KEGG:rno:60349 UCSC:RGD:68353 InParanoid:Q9QWM1 NextBio:612007 PRO:PR:Q9QWM1 Genevestigator:Q9QWM1 Uniprot:Q9QWM1)

HSP 1 Score: 230.72 bits (587), Expect = 2.969e-66
Identity = 135/323 (41.80%), Postives = 181/323 (56.04%), Query Frame = 0
Query:  180 DGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNP---IIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASL-DDREWQSELYKLLQSQSFN---QVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            + +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN+K YTC+ +++C IDKTQRKRCPYCRF+KC+DVGMKLEAVR DRMRGGRNKFGPMYKRDRA K    +Q++ +     +   +M+                         P  + +   N   +  G P++H+     +P      S   TSP  + +P     P G+  G    G  P   I ++  DP       +     + D         +P +I E L    D+ + Q+++   LQ +  N   Q ++  F LLCK+ D  LF+ V+WAR+S +FRELK+
Sbjct:  101 EDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNQKRYTCIENQNCQIDKTQRKRCPYCRFKKCIDVGMKLEAVRADRMRGGRNKFGPMYKRDRALK----QQKKALIRANGLKLEAMSQVIQAM-------------------PSDLTSAIQNIHSASKGLPLSHVA----LPPTDYDRSPFVTSPISMTMP-----PHGSLHGYQPYGHFPNRAIKSEYPDPYSSSPESMMGYS-YMDGYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQNNRNRQEKLSAFGLLCKMADQTLFSIVEWARSSIFFRELKV 390          
BLAST of EMLSAG00000008902 vs. GO
Match: - (symbol:Nr5a2 "nuclear receptor subfamily 5, group A, member 2" species:10116 "Rattus norvegicus" [GO:0003677 "DNA binding" evidence=ISO;ISS] [GO:0003690 "double-stranded DNA binding" evidence=IDA] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISO;ISS] [GO:0003707 "steroid hormone receptor activity" evidence=IEA] [GO:0004879 "ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IDA] [GO:0005543 "phospholipid binding" evidence=ISO] [GO:0005634 "nucleus" evidence=IEA;ISO] [GO:0005737 "cytoplasm" evidence=ISO] [GO:0006355 "regulation of transcription, DNA-templated" evidence=ISO;ISS] [GO:0008206 "bile acid metabolic process" evidence=ISO] [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0008289 "lipid binding" evidence=IEA] [GO:0030522 "intracellular receptor signaling pathway" evidence=IDA] [GO:0042127 "regulation of cell proliferation" evidence=ISO] [GO:0042632 "cholesterol homeostasis" evidence=ISO] [GO:0043565 "sequence-specific DNA binding" evidence=IEA;ISO] [GO:0044212 "transcription regulatory region DNA binding" evidence=ISO] [GO:0045070 "positive regulation of viral genome replication" evidence=ISO] [GO:0045893 "positive regulation of transcription, DNA-templated" evidence=ISO] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=ISO] InterPro:IPR000536 InterPro:IPR001628 InterPro:IPR001723 InterPro:IPR008946 InterPro:IPR013088 Pfam:PF00104 Pfam:PF00105 PRINTS:PR00047 PRINTS:PR00398 PROSITE:PS00031 PROSITE:PS51030 SMART:SM00399 SMART:SM00430 RGD:68353 GO:GO:0005634 GO:GO:0004879 GO:GO:0043565 GO:GO:0003707 GO:GO:0008270 Gene3D:1.10.565.10 Gene3D:3.30.50.10 SUPFAM:SSF48508 GO:GO:0008289 GO:GO:0003690 eggNOG:NOG240365 InterPro:IPR016355 PIRSF:PIRSF002530 CTD:2494 HOGENOM:HOG000063718 HOVERGEN:HBG106677 KO:K08027 TreeFam:TF350737 EMBL:AB012960 EMBL:AB012961 RefSeq:NP_068510.1 RefSeq:XP_006249990.1 UniGene:Rn.42941 ProteinModelPortal:Q9QWM1 SMR:Q9QWM1 PhosphoSite:Q9QWM1 PaxDb:Q9QWM1 GeneID:60349 KEGG:rno:60349 UCSC:RGD:68353 InParanoid:Q9QWM1 NextBio:612007 PRO:PR:Q9QWM1 Genevestigator:Q9QWM1 Uniprot:Q9QWM1)

HSP 1 Score: 230.72 bits (587), Expect = 2.969e-66
Identity = 135/323 (41.80%), Postives = 181/323 (56.04%), Query Frame = 0
Query:  180 DGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNP---IIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASL-DDREWQSELYKLLQSQSFN---QVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            + +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN+K YTC+ +++C IDKTQRKRCPYCRF+KC+DVGMKLEAVR DRMRGGRNKFGPMYKRDRA K    +Q++ +     +   +M+                         P  + +   N   +  G P++H+     +P      S   TSP  + +P     P G+  G    G  P   I ++  DP       +     + D         +P +I E L    D+ + Q+++   LQ +  N   Q ++  F LLCK+ D  LF+ V+WAR+S +FRELK+
Sbjct:  101 EDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNQKRYTCIENQNCQIDKTQRKRCPYCRFKKCIDVGMKLEAVRADRMRGGRNKFGPMYKRDRALK----QQKKALIRANGLKLEAMSQVIQAM-------------------PSDLTSAIQNIHSASKGLPLSHVA----LPPTDYDRSPFVTSPISMTMP-----PHGSLHGYQPYGHFPNRAIKSEYPDPYSSSPESMMGYS-YMDGYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQNNRNRQEKLSAFGLLCKMADQTLFSIVEWARSSIFFRELKV 390          
BLAST of EMLSAG00000008902 vs. C. finmarchicus
Match: gi|592832455|gb|GAXK01125089.1| (TSA: Calanus finmarchicus comp25625_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 371.703 bits (953), Expect = 2.050e-112
Identity = 211/369 (57.18%), Postives = 234/369 (63.41%), Query Frame = 0
Query:  168 GVVGQSDQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARK---------LQVLRQRQVIHGGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYGSPIT----------HIKQEIQIPQVXXXXXXXXXXXXXVHLPGMISNPGGNPMGGDTPGSNPIIAQQTDPAGGIQWQINA----AGKHQD---IQSNQGT-------------GKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKIYI 497
            GV+G S+QPD+KDG+EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARK         LQVLRQRQ+ HGG                                             S +IYG+PIT          HIKQEIQIPQV S  +S   S    ++ G +S           P  +  + Q  DP   IQWQI+     A   +D   I    GT             GK+P  IREFL SLDD+EWQS LY LLQ+Q+FNQVEVDLFEL+CKVLD NLFAQVDWARNSYYF+ELK+ +
Sbjct: 3289 GVIGTSEQPDTKDGLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQFSNCHAPLQVLRQRQLSHGG-----------------------------------------GMVGSNTIYGNPITTSSSWPSNPIHIKQEIQIPQV-SSLTSSPDSSPSPNMMGPVSVQSHLASQQPVPLMSGNMVQHQDPTKSIQWQISTSLAPASVSKDFNYIPQTSGTSGLVSTASSGPVQGKIPPPIREFLKSLDDQEWQSSLYTLLQNQTFNQVEVDLFELMCKVLDQNLFAQVDWARNSYYFKELKLQV 4269          

HSP 2 Score: 52.7582 bits (125), Expect = 2.632e-6
Identity = 22/26 (84.62%), Postives = 24/26 (92.31%), Query Frame = 0
Query:  515 EVRNLNNRTHVQECHEQVHRILLEYC 540
            EVRNLNNR HVQEC EQVH+IL+EYC
Sbjct: 2953 EVRNLNNRAHVQECSEQVHQILMEYC 3030          
BLAST of EMLSAG00000008902 vs. C. finmarchicus
Match: gi|592829906|gb|GAXK01127638.1| (TSA: Calanus finmarchicus comp171820_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 133.65 bits (335), Expect = 6.178e-32
Identity = 62/105 (59.05%), Postives = 72/105 (68.57%), Query Frame = 0
Query:  179 KDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRN----------KFGPMYK 273
            +D    +C +C DK +G HYG++TCE CKGFFKRTVQNK+VYTCVAD  C I+K QR RC +CRFQKCL  GM L AVR DRM GGRN          K GP +K
Sbjct: 1636 EDDQPMICMICEDKATGLHYGIITCEGCKGFFKRTVQNKRVYTCVADGHCEINKAQRNRCQFCRFQKCLQRGMVLAAVREDRMPGGRNSGAVYNMYPLKVGPQHK 1950          
BLAST of EMLSAG00000008902 vs. C. finmarchicus
Match: gi|592829908|gb|GAXK01127636.1| (TSA: Calanus finmarchicus comp171820_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 133.65 bits (335), Expect = 6.317e-32
Identity = 62/105 (59.05%), Postives = 72/105 (68.57%), Query Frame = 0
Query:  179 KDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRN----------KFGPMYK 273
            +D    +C +C DK +G HYG++TCE CKGFFKRTVQNK+VYTCVAD  C I+K QR RC +CRFQKCL  GM L AVR DRM GGRN          K GP +K
Sbjct: 1636 EDDQPMICMICEDKATGLHYGIITCEGCKGFFKRTVQNKRVYTCVADGHCEINKAQRNRCQFCRFQKCLQRGMVLAAVREDRMPGGRNSGAVYNMYPLKVGPQHK 1950          
BLAST of EMLSAG00000008902 vs. C. finmarchicus
Match: gi|592829905|gb|GAXK01127639.1| (TSA: Calanus finmarchicus comp171820_c0_seq4 transcribed RNA sequence)

HSP 1 Score: 133.65 bits (335), Expect = 6.386e-32
Identity = 62/105 (59.05%), Postives = 72/105 (68.57%), Query Frame = 0
Query:  179 KDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRN----------KFGPMYK 273
            +D    +C +C DK +G HYG++TCE CKGFFKRTVQNK+VYTCVAD  C I+K QR RC +CRFQKCL  GM L AVR DRM GGRN          K GP +K
Sbjct: 1621 EDDQPMICMICEDKATGLHYGIITCEGCKGFFKRTVQNKRVYTCVADGHCEINKAQRNRCQFCRFQKCLQRGMVLAAVREDRMPGGRNSGAVYNMYPLKVGPQHK 1935          
BLAST of EMLSAG00000008902 vs. C. finmarchicus
Match: gi|592829907|gb|GAXK01127637.1| (TSA: Calanus finmarchicus comp171820_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 133.65 bits (335), Expect = 6.531e-32
Identity = 62/105 (59.05%), Postives = 72/105 (68.57%), Query Frame = 0
Query:  179 KDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRN----------KFGPMYK 273
            +D    +C +C DK +G HYG++TCE CKGFFKRTVQNK+VYTCVAD  C I+K QR RC +CRFQKCL  GM L AVR DRM GGRN          K GP +K
Sbjct: 1621 EDDQPMICMICEDKATGLHYGIITCEGCKGFFKRTVQNKRVYTCVADGHCEINKAQRNRCQFCRFQKCLQRGMVLAAVREDRMPGGRNSGAVYNMYPLKVGPQHK 1935          
BLAST of EMLSAG00000008902 vs. C. finmarchicus
Match: gi|592874024|gb|GAXK01083538.1| (TSA: Calanus finmarchicus comp176096_c4_seq1 transcribed RNA sequence)

HSP 1 Score: 131.724 bits (330), Expect = 1.551e-31
Identity = 53/83 (63.86%), Postives = 65/83 (78.31%), Query Frame = 0
Query:  186 CPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKF 268
            CP+CGDK+SG+HYG+ +CESCKGFFKRTVQNKK Y C+    C +    RK+CP CRF KCL +GMKLEA+R DR RGGR+ +
Sbjct:  786 CPICGDKISGFHYGIFSCESCKGFFKRTVQNKKNYVCLRGSQCPVSIGTRKKCPACRFDKCLKMGMKLEAIREDRTRGGRSTY 1034          
BLAST of EMLSAG00000008902 vs. C. finmarchicus
Match: gi|592878692|gb|GAXK01079209.1| (TSA: Calanus finmarchicus comp267685_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 119.783 bits (299), Expect = 1.342e-27
Identity = 52/94 (55.32%), Postives = 64/94 (68.09%), Query Frame = 0
Query:  175 QPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKF 268
            QP +  GM  LC VCGD  +  HYG+ TCE CKGFFKRTVQ    Y C+AD++C +DK +R RC +CRFQKCL VGM  E VR D ++G R + 
Sbjct: 1131 QPSTPQGMVLLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDGLKGRRGRL 1412          
BLAST of EMLSAG00000008902 vs. C. finmarchicus
Match: gi|592874034|gb|GAXK01083528.1| (TSA: Calanus finmarchicus comp176096_c2_seq9 transcribed RNA sequence)

HSP 1 Score: 111.309 bits (277), Expect = 4.707e-27
Identity = 47/75 (62.67%), Postives = 57/75 (76.00%), Query Frame = 0
Query:  194 SGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKF 268
            SG+HYG+ +CESCKGFFKRTVQNKK Y C+    C +    RK+CP CRF KCL +GMKLEA+R DR RGGR+ +
Sbjct:    2 SGFHYGIFSCESCKGFFKRTVQNKKNYVCLRGSQCPVSIGTRKKCPACRFDKCLKMGMKLEAIREDRTRGGRSTY 226          
BLAST of EMLSAG00000008902 vs. C. finmarchicus
Match: gi|592874035|gb|GAXK01083527.1| (TSA: Calanus finmarchicus comp176096_c2_seq8 transcribed RNA sequence)

HSP 1 Score: 111.309 bits (277), Expect = 4.707e-27
Identity = 47/75 (62.67%), Postives = 57/75 (76.00%), Query Frame = 0
Query:  194 SGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKF 268
            SG+HYG+ +CESCKGFFKRTVQNKK Y C+    C +    RK+CP CRF KCL +GMKLEA+R DR RGGR+ +
Sbjct:    2 SGFHYGIFSCESCKGFFKRTVQNKKNYVCLRGSQCPVSIGTRKKCPACRFDKCLKMGMKLEAIREDRTRGGRSTY 226          
BLAST of EMLSAG00000008902 vs. C. finmarchicus
Match: gi|592793189|gb|GAXK01161379.1| (TSA: Calanus finmarchicus comp35375_c1_seq3 transcribed RNA sequence)

HSP 1 Score: 114.775 bits (286), Expect = 5.151e-26
Identity = 46/85 (54.12%), Postives = 62/85 (72.94%), Query Frame = 0
Query:  181 GMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGR 265
            G + +C +CGD+ SG HYG+ +CE CKGFFKRTV+ +  Y C  D+ C+IDK QR RC +CR+ KC+ +GMK EAV+ +R RG R
Sbjct:  780 GAKHMCSICGDRASGKHYGVYSCEGCKGFFKRTVRKELSYACREDKQCLIDKRQRNRCQFCRYNKCMAMGMKREAVQEERQRGSR 1034          
BLAST of EMLSAG00000008902 vs. L. salmonis peptides
Match: EMLSAP00000008902 (pep:novel supercontig:LSalAtl2s:LSalAtl2s554:572309:581835:1 gene:EMLSAG00000008902 transcript:EMLSAT00000008902 description:"maker-LSalAtl2s554-snap-gene-5.6")

HSP 1 Score: 1105.89 bits (2859), Expect = 0.000e+0
Identity = 540/540 (100.00%), Postives = 540/540 (100.00%), Query Frame = 0
Query:    1 MLPTEPLISIPYSNQRGRFHQPHIQXLPLAAPGSNHRSSSLILIKKEPNMSTSGSLSSGGSPPMVGGTLLPTMDMPIGNSFASLEDLSSVVHPLGLGGGGPGSGGNPVDSGSNNSPPTLSYSTSPTHNMLGLLPDNNSCNLFNPSAGLPTASSNNNSAGSTSGDFGPGVVGQSDQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNPIIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKIYIYFISVFLILSFLFFLPLEVRNLNNRTHVQECHEQVHRILLEYC 540
            MLPTEPLISIPYSNQRGRFHQPHIQXLPLAAPGSNHRSSSLILIKKEPNMSTSGSLSSGGSPPMVGGTLLPTMDMPIGNSFASLEDLSSVVHPLGLGGGGPGSGGNPVDSGSNNSPPTLSYSTSPTHNMLGLLPDNNSCNLFNPSAGLPTASSNNNSAGSTSGDFGPGVVGQSDQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNPIIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKIYIYFISVFLILSFLFFLPLEVRNLNNRTHVQECHEQVHRILLEYC
Sbjct:    1 MLPTEPLISIPYSNQRGRFHQPHIQXLPLAAPGSNHRSSSLILIKKEPNMSTSGSLSSGGSPPMVGGTLLPTMDMPIGNSFASLEDLSSVVHPLGLGGGGPGSGGNPVDSGSNNSPPTLSYSTSPTHNMLGLLPDNNSCNLFNPSAGLPTASSNNNSAGSTSGDFGPGVVGQSDQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNPIIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKIYIYFISVFLILSFLFFLPLEVRNLNNRTHVQECHEQVHRILLEYC 540          
BLAST of EMLSAG00000008902 vs. L. salmonis peptides
Match: EMLSAP00000004451 (pep:novel supercontig:LSalAtl2s:LSalAtl2s231:945915:949068:1 gene:EMLSAG00000004451 transcript:EMLSAT00000004451 description:"snap_masked-LSalAtl2s231-processed-gene-9.18")

HSP 1 Score: 137.117 bits (344), Expect = 4.432e-35
Identity = 55/87 (63.22%), Postives = 68/87 (78.16%), Query Frame = 0
Query:  186 CPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMY 272
            CPVCGDK+SG+HYG+ +CESCKGFFKRTVQNKK Y C+    C +  + RK+CP CRF KCL++GMKLEA+R DR RGGR+ +   Y
Sbjct:  155 CPVCGDKISGFHYGIFSCESCKGFFKRTVQNKKNYVCLRGSQCPVTISTRKKCPACRFDKCLNIGMKLEAIREDRTRGGRSTYQCSY 241          
BLAST of EMLSAG00000008902 vs. L. salmonis peptides
Match: EMLSAP00000001919 (pep:novel supercontig:LSalAtl2s:LSalAtl2s132:616435:622808:1 gene:EMLSAG00000001919 transcript:EMLSAT00000001919 description:"augustus_masked-LSalAtl2s132-processed-gene-6.5")

HSP 1 Score: 120.168 bits (300), Expect = 1.043e-29
Identity = 49/83 (59.04%), Postives = 60/83 (72.29%), Query Frame = 0
Query:  181 GMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRG 263
            G +  C +CGD+ SG HYG+ +CE CKGFFKRTV+ +  Y C  +R CVIDK QR RC YCR+ KCLD GMK EAV+ +R RG
Sbjct:   86 GSKHFCSICGDRASGKHYGVYSCEGCKGFFKRTVRKELTYACRENRDCVIDKRQRNRCQYCRYMKCLDTGMKREAVQEERHRG 168          
BLAST of EMLSAG00000008902 vs. L. salmonis peptides
Match: EMLSAP00000013004 (pep:novel supercontig:LSalAtl2s:LSalAtl2s98:942409:953748:1 gene:EMLSAG00000013004 transcript:EMLSAT00000013004 description:"augustus_masked-LSalAtl2s98-processed-gene-9.1")

HSP 1 Score: 117.087 bits (292), Expect = 8.183e-28
Identity = 48/84 (57.14%), Postives = 59/84 (70.24%), Query Frame = 0
Query:  185 LCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKF 268
            LC VCGD  +  HYG+ TCE CKGFFKRTVQ    Y C+AD++C +DK +R RC +CRFQKCL VGM  E VR D ++G R + 
Sbjct:  408 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRL 491          
BLAST of EMLSAG00000008902 vs. L. salmonis peptides
Match: EMLSAP00000008071 (pep:novel supercontig:LSalAtl2s:LSalAtl2s47:304551:317770:1 gene:EMLSAG00000008071 transcript:EMLSAT00000008071 description:"snap_masked-LSalAtl2s47-processed-gene-3.10")

HSP 1 Score: 114.775 bits (286), Expect = 1.866e-27
Identity = 51/98 (52.04%), Postives = 63/98 (64.29%), Query Frame = 0
Query:  174 DQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPM 271
            D    ++G    C VCGD  SG+HYG+ +CE+CK FFKRT+Q    YT  A   C I+K +RK C  CRFQKCL +GM  E VR DR+RGGR K+  M
Sbjct:  259 DIIKEEEGQRRTCLVCGDIASGFHYGVSSCEACKAFFKRTIQGNIEYTXPASNECEINKRRRKACQACRFQKCLRMGMLKEGVRLDRVRGGRQKYRRM 356          
BLAST of EMLSAG00000008902 vs. L. salmonis peptides
Match: EMLSAP00000009969 (pep:novel supercontig:LSalAtl2s:LSalAtl2s651:302705:304416:-1 gene:EMLSAG00000009969 transcript:EMLSAT00000009969 description:"maker-LSalAtl2s651-augustus-gene-2.5")

HSP 1 Score: 99.7525 bits (247), Expect = 1.619e-22
Identity = 42/78 (53.85%), Postives = 54/78 (69.23%), Query Frame = 0
Query:  183 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDR 260
            E LC VCGDK SG HYG  TCE CK FFKR V+    + C + +SC +D+  R +C +CRF+KCL++GMK EAV+  R
Sbjct:   72 EILCVVCGDKSSGKHYGQFTCEGCKSFFKRCVRRSLTFQCRSKKSCPVDQHHRNQCQHCRFKKCLNMGMKKEAVQKGR 149          
BLAST of EMLSAG00000008902 vs. L. salmonis peptides
Match: EMLSAP00000007361 (pep:novel supercontig:LSalAtl2s:LSalAtl2s418:374353:376789:1 gene:EMLSAG00000007361 transcript:EMLSAT00000007361 description:"maker-LSalAtl2s418-augustus-gene-3.13")

HSP 1 Score: 100.138 bits (248), Expect = 1.631e-22
Identity = 36/77 (46.75%), Postives = 56/77 (72.73%), Query Frame = 0
Query:  186 CPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMR 262
            C VCGD+ +G HYG  +C+ CKGFF+R+V+ ++VY C  +R+C+++K +R  C YCR + C+  GMK  AV+++R R
Sbjct:  151 CAVCGDRATGKHYGAASCDGCKGFFRRSVRKERVYGCRQNRACIVNKDKRNNCRYCRLKMCIKAGMKKSAVQNERDR 227          
BLAST of EMLSAG00000008902 vs. L. salmonis peptides
Match: EMLSAP00000007894 (pep:novel supercontig:LSalAtl2s:LSalAtl2s466:351370:353021:1 gene:EMLSAG00000007894 transcript:EMLSAT00000007894 description:"maker-LSalAtl2s466-augustus-gene-2.7")

HSP 1 Score: 97.8265 bits (242), Expect = 4.370e-22
Identity = 46/108 (42.59%), Postives = 68/108 (62.96%), Query Frame = 0
Query:  161 TSGDFGPGVVGQSDQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA--DRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRN 266
            +S +FG     +S Q  S+   +  C VC D  SG HYG+  C+ C GFFKR+++  ++Y C A  + SC++DKT R +C  CR ++C+DVGM  +AV+H+  RG RN
Sbjct:   13 SSPEFG----AKSQQTSSRILYDIPCKVCTDHSSGKHYGIFACDGCAGFFKRSIRRNRLYVCKAKSEGSCLVDKTHRNQCRACRLKRCVDVGMNKDAVQHE--RGPRN 114          
BLAST of EMLSAG00000008902 vs. L. salmonis peptides
Match: EMLSAP00000009940 (pep:novel supercontig:LSalAtl2s:LSalAtl2s649:353131:422335:-1 gene:EMLSAG00000009940 transcript:EMLSAT00000009940 description:"maker-LSalAtl2s649-augustus-gene-4.7")

HSP 1 Score: 97.4413 bits (241), Expect = 1.767e-21
Identity = 42/93 (45.16%), Postives = 57/93 (61.29%), Query Frame = 0
Query:  179 KDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPM 271
            ++G +  C VCGDK SG HYG  TCE CK FFKR+V+    Y C   RSC ID+  R +C +CR +KC+ +GM+ EAV+  R+   +    P 
Sbjct:  427 ENGQDISCVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRALTYQCRGSRSCPIDQHHRNQCQHCRLKKCIKMGMRKEAVQRGRIPASQQNVLPF 519          
BLAST of EMLSAG00000008902 vs. L. salmonis peptides
Match: EMLSAP00000012486 (pep:novel supercontig:LSalAtl2s:LSalAtl2s91:348479:353390:-1 gene:EMLSAG00000012486 transcript:EMLSAT00000012486 description:"maker-LSalAtl2s91-snap-gene-4.8")

HSP 1 Score: 95.9005 bits (237), Expect = 6.037e-21
Identity = 36/70 (51.43%), Postives = 49/70 (70.00%), Query Frame = 0
Query:  184 ELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKL 253
            E C VCGD+ SG HYG ++CE CKGFFKR+++ +  Y C  ++ C + K  R RC YCR QKCL +GM++
Sbjct:  218 EACVVCGDRASGRHYGAISCEGCKGFFKRSIRKQLGYQCRGNKDCEVTKHHRNRCQYCRLQKCLAMGMRI 287          
BLAST of EMLSAG00000008902 vs. SwissProt
Match: gi|44889025|sp|P49867.2|FTZF1_BOMMO (RecName: Full=Nuclear hormone receptor FTZ-F1; AltName: Full=BmFTZ-F1; AltName: Full=Nuclear receptor subfamily 5 group A member 3)

HSP 1 Score: 329.331 bits (843), Expect = 1.875e-105
Identity = 183/341 (53.67%), Postives = 217/341 (63.64%), Query Frame = 0
Query:  159 GSTSGDFGPGVVGQSDQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPIT--HIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNPIIAQQTDPAGGIQWQINAAGKHQDI--QSNQGTGKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            G   G + P      DQ D+KD +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA+R+C IDKTQRKRCP+CRFQKCLDVGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQ++RQRQ+                 T   S   GG   G                      +GSP T   +KQEIQIPQV+S+TSSP++SP P  L      P   P               +  A     Q N A         ++  T ++  +IREF+ ++DDREWQ+ L+ LLQSQ++NQ EVDLFEL+CKVLD NLF+QVDWARN+ +F+ LK+
Sbjct:   62 GGEPGAYLPTAGTVCDQTDTKDVIEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERACHIDKTQRKRCPFCRFQKCLDVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQMMRQRQI--------------AVQTLRGSLGDGGLVLG----------------------FGSPYTAVSVKQEIQIPQVSSLTSSPESSPGPALLGAQPQPPQPPPPPTHDKWEAHSPHSASPDAFTFDTQSNTAATPSSTAEATSTETLRVSPMIREFVQTVDDREWQNALFGLLQSQTYNQCEVDLFELMCKVLDQNLFSQVDWARNTVFFKYLKV 366          
BLAST of EMLSAG00000008902 vs. SwissProt
Match: gi|45644987|sp|P33244.2|FTZF1_DROME (RecName: Full=Nuclear hormone receptor FTZ-F1; AltName: Full=FTZ-F1 alpha; AltName: Full=Nuclear receptor subfamily 5 group A member 3)

HSP 1 Score: 255.758 bits (652), Expect = 1.519e-73
Identity = 130/200 (65.00%), Postives = 144/200 (72.00%), Query Frame = 0
Query:  177 DSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGV--SMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHL 374
            D K   EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA+RSC IDKTQRKRCPYCRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQV+RQRQ+    +  SMGP  +  T  +     +Y              P+MN                 IKQEIQIPQV+S+T SPD+SPSP+ +
Sbjct:  499 DFKHLFEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQVMRQRQLALQALRNSMGP-DIKPTPISPGYQQAY--------------PNMN-----------------IKQEIQIPQVSSLTQSPDSSPSPIAI 666          

HSP 2 Score: 113.235 bits (282), Expect = 5.502e-25
Identity = 44/68 (64.71%), Postives = 61/68 (89.71%), Query Frame = 0
Query:  428 KMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            ++  +IREF+ S+DDREWQ++L+ LLQ Q++NQVEVDLFEL+CKVLD NLF+QVDWARN+ +F++LK+
Sbjct:  792 RVSPMIREFVQSIDDREWQTQLFALLQKQTYNQVEVDLFELMCKVLDQNLFSQVDWARNTVFFKDLKV 859          
BLAST of EMLSAG00000008902 vs. SwissProt
Match: gi|7676159|sp|P45448.3|NR5A2_MOUSE (RecName: Full=Nuclear receptor subfamily 5 group A member 2; AltName: Full=Liver receptor homolog 1; Short=LRH-1)

HSP 1 Score: 234.958 bits (598), Expect = 4.504e-69
Identity = 136/320 (42.50%), Postives = 181/320 (56.56%), Query Frame = 0
Query:  180 DGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNPIIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASL-DDREWQSELYKLLQSQSFN---QVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            + +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN+K YTC+ +++C IDKTQRKRCPYCRF+KC+DVGMKLEAVR DRMRGGRNKFGPMYKRDRA K    +Q++ +     +   +M+                         P  + +   N   +  G P++H+     +P      S   TSP  + +P   S  G  P G     S  I ++  DP       +         Q+N     +P +I E L    D+ + Q+++   LQ +  N   Q ++  F LLCK+ D  LF+ V+WAR+S +FRELK+
Sbjct:  101 EDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNQKRYTCIENQNCQIDKTQRKRCPYCRFKKCIDVGMKLEAVRADRMRGGRNKFGPMYKRDRALK----QQKKALIRANGLKLEAMSQVIQAM-------------------PSDLTSAIQNIHSASKGLPLSHVA----LPPTDYDRSPFVTSPISMTMPPHSSLHGYQPYGHFP--SRAIKSEYPDPYSSSPESMMGYSYMDGYQTN-SPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQSNRNRQEKLSAFGLLCKMADQTLFSIVEWARSSIFFRELKV 390          
BLAST of EMLSAG00000008902 vs. SwissProt
Match: gi|7676156|sp|O00482.2|NR5A2_HUMAN (RecName: Full=Nuclear receptor subfamily 5 group A member 2; AltName: Full=Alpha-1-fetoprotein transcription factor; AltName: Full=B1-binding factor; Short=hB1F; AltName: Full=CYP7A promoter-binding factor; AltName: Full=Hepatocytic transcription factor; AltName: Full=Liver receptor homolog 1; Short=LRH-1)

HSP 1 Score: 233.802 bits (595), Expect = 9.871e-69
Identity = 139/327 (42.51%), Postives = 184/327 (56.27%), Query Frame = 0
Query:  180 DGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQ---VLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGG-MNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNP---IIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASL-DDREWQSELYKLLQSQSFNQV---EVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            + +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN K YTC+ +++C IDKTQRKRCPYCRFQKCL VGMKLEAVR DRMRGGRNKFGPMYKRDRA K Q   ++R   +    +S    +M +  T +S+  +    + G  +N    PP+    + + SP +                         TSP  + +P     P G+  G  T G  P   I ++  DP       I     + D         +P +I E L    D+ + Q+++   LQ +  N+    ++  F L+CK+ D  LF+ V+WAR+S +FRELK+
Sbjct:   80 EDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPT----DYDRSPFV-------------------------TSPISMTMP-----PHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYS-YMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKV 371          
BLAST of EMLSAG00000008902 vs. SwissProt
Match: gi|3334187|sp|O42101.1|NR5A2_CHICK (RecName: Full=Nuclear receptor subfamily 5 group A member 2; AltName: Full=FTF/LRH-1; AltName: Full=OR2.0)

HSP 1 Score: 231.876 bits (590), Expect = 1.803e-68
Identity = 141/331 (42.60%), Postives = 184/331 (55.59%), Query Frame = 0
Query:  180 DGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNN------TXTTTSSSASYGGGASGG--MNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNP---IIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASL-DDREWQSELYKLLQSQSFNQ---VEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            + +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN K YTC+ +++C IDKTQRKRCPYCRFQKCL VGMKLEAVR DRMRGGRNKFGPMYKRDRA K    +Q++ +     +   +M        T  T SS+      AS G  +N T  PP+    + + SP +                         TSP  + +P     P G+  G  T G  P   I ++  DP       I     + D         +P +I E      D+ + Q+++   LQ +  N+    +++ F L+CK+ D  LF+ V+WAR+S +FRELK+
Sbjct:   40 EDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALK----QQKKALIRANGLKLEAMTQVIQAMPTDLTISSAIQNIHSASKGLPLNHTALPPT----DYDRSPFV-------------------------TSPISMTMP-----PHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYS-YMDGYQTSSPASIPHLILELQKCEPDEPQVQAKIMAYLQQEQANRSKHEKLNTFGLMCKMADQTLFSIVEWARSSIFFRELKV 331          
BLAST of EMLSAG00000008902 vs. SwissProt
Match: gi|81907060|sp|Q9QWM1.1|NR5A2_RAT (RecName: Full=Nuclear receptor subfamily 5 group A member 2; AltName: Full=FTZ-F1 beta; AltName: Full=Liver receptor homolog 1; Short=LRH-1)

HSP 1 Score: 230.72 bits (587), Expect = 1.833e-67
Identity = 135/323 (41.80%), Postives = 181/323 (56.04%), Query Frame = 0
Query:  180 DGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNP---IIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASL-DDREWQSELYKLLQSQSFN---QVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            + +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN+K YTC+ +++C IDKTQRKRCPYCRF+KC+DVGMKLEAVR DRMRGGRNKFGPMYKRDRA K    +Q++ +     +   +M+                         P  + +   N   +  G P++H+     +P      S   TSP  + +P     P G+  G    G  P   I ++  DP       +     + D         +P +I E L    D+ + Q+++   LQ +  N   Q ++  F LLCK+ D  LF+ V+WAR+S +FRELK+
Sbjct:  101 EDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNQKRYTCIENQNCQIDKTQRKRCPYCRFKKCIDVGMKLEAVRADRMRGGRNKFGPMYKRDRALK----QQKKALIRANGLKLEAMSQVIQAM-------------------PSDLTSAIQNIHSASKGLPLSHVA----LPPTDYDRSPFVTSPISMTMP-----PHGSLHGYQPYGHFPNRAIKSEYPDPYSSSPESMMGYS-YMDGYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQNNRNRQEKLSAFGLLCKMADQTLFSIVEWARSSIFFRELKV 390          
BLAST of EMLSAG00000008902 vs. SwissProt
Match: gi|1703164|sp|P50569.1|STF1_RAT (RecName: Full=Steroidogenic factor 1; Short=SF-1; Short=STF-1; AltName: Full=Adrenal 4-binding protein; AltName: Full=Fushi tarazu factor homolog 1; AltName: Full=Nuclear receptor subfamily 5 group A member 1; AltName: Full=Steroid hormone receptor Ad4BP)

HSP 1 Score: 191.43 bits (485), Expect = 1.101e-53
Identity = 87/116 (75.00%), Postives = 97/116 (83.62%), Query Frame = 0
Query:  180 DGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSM 295
            + ++ELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN K YTC   +SC IDKTQRKRCP+CRFQKCL VGM+LEAVR DRMRGGRNKFGPMYKRDRA K Q  ++ Q+   G  +
Sbjct:    7 EDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQ--KKAQIRANGFKL 120          
BLAST of EMLSAG00000008902 vs. SwissProt
Match: gi|341942103|sp|P33242.3|STF1_MOUSE (RecName: Full=Steroidogenic factor 1; Short=SF-1; Short=STF-1; AltName: Full=Adrenal 4-binding protein; AltName: Full=Embryonal LTR-binding protein; Short=ELP; AltName: Full=Embryonal long terminal repeat-binding protein; AltName: Full=Fushi tarazu factor homolog 1; AltName: Full=Nuclear receptor subfamily 5 group A member 1; AltName: Full=Steroid hormone receptor Ad4BP; AltName: Full=Steroid hydroxylase positive regulator)

HSP 1 Score: 191.43 bits (485), Expect = 1.136e-53
Identity = 87/116 (75.00%), Postives = 97/116 (83.62%), Query Frame = 0
Query:  180 DGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSM 295
            + ++ELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN K YTC   +SC IDKTQRKRCP+CRFQKCL VGM+LEAVR DRMRGGRNKFGPMYKRDRA K Q  ++ Q+   G  +
Sbjct:    7 EDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQ--KKAQIRANGFKL 120          
BLAST of EMLSAG00000008902 vs. SwissProt
Match: gi|416584|sp|Q04752.1|STF1_BOVIN (RecName: Full=Steroidogenic factor 1; Short=SF-1; Short=STF-1; AltName: Full=Adrenal 4-binding protein; AltName: Full=Fushi tarazu factor homolog 1; AltName: Full=Nuclear receptor subfamily 5 group A member 1; AltName: Full=Steroid hormone receptor Ad4BP)

HSP 1 Score: 191.43 bits (485), Expect = 1.232e-53
Identity = 85/102 (83.33%), Postives = 91/102 (89.22%), Query Frame = 0
Query:  180 DGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQ 281
            + ++ELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN K YTC   +SC IDKTQRKRCP+CRFQKCL VGM+LEAVR DRMRGGRNKFGPMYKRDRA K Q
Sbjct:    7 EDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQ 108          
BLAST of EMLSAG00000008902 vs. SwissProt
Match: gi|160221327|sp|P79387.3|STF1_PIG (RecName: Full=Steroidogenic factor 1; Short=SF-1; Short=STF-1; AltName: Full=Adrenal 4-binding protein; AltName: Full=Fushi tarazu factor homolog 1; AltName: Full=Nuclear receptor subfamily 5 group A member 1; AltName: Full=Steroid hormone receptor Ad4BP)

HSP 1 Score: 191.43 bits (485), Expect = 1.366e-53
Identity = 85/102 (83.33%), Postives = 91/102 (89.22%), Query Frame = 0
Query:  180 DGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQ 281
            + ++ELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN K YTC   +SC IDKTQRKRCP+CRFQKCL VGM+LEAVR DRMRGGRNKFGPMYKRDRA K Q
Sbjct:    7 EDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQ 108          
BLAST of EMLSAG00000008902 vs. Select Arthropod Genomes
Match: gb|KYB28389.1| (ftz transcription factor 1 [Tribolium castaneum])

HSP 1 Score: 331.643 bits (849), Expect = 5.541e-106
Identity = 177/349 (50.72%), Postives = 213/349 (61.03%), Query Frame = 0
Query:  174 DQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQV-----------------------TSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNPIIAQQTDPAG----GIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            D PD+KDG+EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA+RSC IDKTQRKRCPYCRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQ++RQRQ+                     +A    G+S G     S P  +   N            HIKQEIQIPQV                       +++     +    + + G+   P    MG D        +  T P        Q+     G      S   + K+  +IR+F+ ++DDREWQ+ LY LLQ+Q++NQ EVDLFEL+CKVLD NLF+QVDWARNS +F++LK+
Sbjct:  104 DLPDTKDGIEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQMMRQRQL---------------------AAQTLRGSSLGDAMYSSQPGTSPFAN-----------IHIKQEIQIPQVSSLTSSPDSSPSPIAVALGQVNTSNLVQQASSQQPALQIVGVPGGPSSMVMGPDNKLWGSANSTTTSPHSLSPKAFQFDTVVQGG-----SAPPSSKVSPLIRDFVQAIDDREWQNSLYTLLQNQTYNQCEVDLFELMCKVLDQNLFSQVDWARNSVFFKDLKV 415          
BLAST of EMLSAG00000008902 vs. Select Arthropod Genomes
Match: gb|EFA01263.2| (ftz transcription factor 1 [Tribolium castaneum])

HSP 1 Score: 331.257 bits (848), Expect = 7.139e-106
Identity = 177/349 (50.72%), Postives = 213/349 (61.03%), Query Frame = 0
Query:  174 DQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQV-----------------------TSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNPIIAQQTDPAG----GIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            D PD+KDG+EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA+RSC IDKTQRKRCPYCRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQ++RQRQ+                     +A    G+S G     S P  +   N            HIKQEIQIPQV                       +++     +    + + G+   P    MG D        +  T P        Q+     G      S   + K+  +IR+F+ ++DDREWQ+ LY LLQ+Q++NQ EVDLFEL+CKVLD NLF+QVDWARNS +F++LK+
Sbjct:  104 DLPDTKDGIEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQMMRQRQL---------------------AAQTLRGSSLGDAMYSSQPGTSPFAN-----------IHIKQEIQIPQVSSLTSSPDSSPSPIAVALGQVNTSNLVQQASSQQPALQIVGVPGGPSSMVMGPDNKLWGSANSTTTSPHSLSPKAFQFDTVVQGG-----SAPPSSKVSPLIRDFVQAIDDREWQNSLYTLLQNQTYNQCEVDLFELMCKVLDQNLFSQVDWARNSVFFKDLKV 415          
BLAST of EMLSAG00000008902 vs. Select Arthropod Genomes
Match: XP_006557455.1 (PREDICTED: nuclear hormone receptor FTZ-F1 [Apis mellifera])

HSP 1 Score: 328.176 bits (840), Expect = 3.155e-102
Identity = 191/352 (54.26%), Postives = 233/352 (66.19%), Query Frame = 0
Query:  173 SDQPDSKDGM-EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHL-PGMISNPGGNPMGGD---TPGSNPIIA-----QQTDPAGGIQWQINAAGK-----------HQDIQSNQGTGKMPA--------IIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            S+ PD+KD + EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA+RSC IDKTQRKRCPYCRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQ++RQRQ+                            A   +  +   PS       N PS   +P  HIKQEIQIPQV+S+TSSPD+SPSP  +  G+++   G+  G      P S P I+        +P  G+  ++ AA              Q  QS+  TG  P+        +IR+F+ ++DDREWQ+ L+ LLQ+Q++NQ EVDLFEL+CKVLD NLF+QVDWARNS +F++LK+
Sbjct:  343 SEFPDTKDIIIEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQMMRQRQL----------------------------ALQTIRGSLGDPS-------NYPSAV-TPFLHIKQEIQIPQVSSLTSSPDSSPSPAAVAAGLVTTQAGSGAGQHQLIAPSSQPNISAGNHLHNLNP--GLDSKLWAANSTTPSPKAFNFGEQSTQSHGATGSAPSTATLKTSPMIRDFVQTVDDREWQASLFGLLQNQTYNQCEVDLFELMCKVLDQNLFSQVDWARNSVFFKDLKV 656          

HSP 2 Score: 73.559 bits (179), Expect = 8.994e-13
Identity = 32/46 (69.57%), Postives = 37/46 (80.43%), Query Frame = 0
Query:  181 GMEELCPVCGDKVSGYHYGLLTCESCKGFFKRT---VQNKKVYTCV 223
             +EE CP+CGDK+SGY YGLLTCESCKGFFKR      +KKVYTC+
Sbjct:  103 ALEERCPMCGDKMSGYQYGLLTCESCKGFFKRNNSPCSSKKVYTCL 148          
BLAST of EMLSAG00000008902 vs. Select Arthropod Genomes
Match: gb|KPM05140.1| (nuclear hormone receptor FTZ-F1-like protein [Sarcoptes scabiei])

HSP 1 Score: 302.753 bits (774), Expect = 1.625e-94
Identity = 181/366 (49.45%), Postives = 220/366 (60.11%), Query Frame = 0
Query:  177 DSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNN----SPSIYGSPITHIKQE-IQIPQVTSMTSSPDTSPSPVH--------------LPGMISN------------PGGNPMGGDTPGSNPIIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGK---------------MPAIIREFLASL-DDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            D KD +EELCPVCGD+VSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA+R+C IDK+QRKRCPYCRFQKCLDVGMKLEAVR DRMRGGRNKFGPMYKRDRAR+LQ+LRQ+Q            ++        +   G G  G      S P    N   N    +PS + S    IK E IQIPQ++S TSSPD+SPSP                LP  +S             P       +   S   +  Q      I+W  N+ G    I     +GK               +P +IRE   S+  D+EWQ++L+ LLQ+Q++NQ EVDLFEL+CKV+D +LFAQVDWARNS +F++LK+
Sbjct:   84 DPKDCIEELCPVCGDRVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERNCHIDKSQRKRCPYCRFQKCLDVGMKLEAVRADRMRGGRNKFGPMYKRDRARRLQLLRQKQ------------LSKVHHVIGGATGSGIGPPGATMMPGSIPGSTANEALNFLHANPSSHNSLFDGIKTELIQIPQLSSSTSSPDSSPSPGSTVAAVAAAASAGNSLPNAVSAVASGHHFMSPLVPSNLQQSTNLGNSAITLMNQNGGDHSIKWPQNSPGPSNLINHTGPSGKSSLNVTQHYEPNKLILPPLIRELQLSMPSDKEWQTQLFSLLQNQTYNQCEVDLFELMCKVIDQSLFAQVDWARNSIFFKDLKV 437          
BLAST of EMLSAG00000008902 vs. Select Arthropod Genomes
Match: EFX77612.1 (hypothetical protein DAPPUDRAFT_305379 [Daphnia pulex])

HSP 1 Score: 262.692 bits (670), Expect = 7.365e-81
Identity = 158/342 (46.20%), Postives = 188/342 (54.97%), Query Frame = 0
Query:  163 GDFGPGVVGQSDQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISN---------PGGNPMGGDTPGSNPIIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            G  G    G+ D PD+K+G+EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKK Y+CVADRSC IDK+QRKRCPYCRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQV+R+RQ+        P        ++S            ++S  S P  + +    S    G   T        PQ  S TSS   SP   H  G+++            G+  G   P   P+I +        +WQ    G  Q    NQ                     + +L++LL                CKVLD NLF QVDWARNSYYF++LK+
Sbjct:   19 GTSGGSSTGRHDLPDTKEGIEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKAYSCVADRSCHIDKSQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQVMRERQLT------TPRGGGGGGGSSSGGGVKHEIQIAQVSSLTSSPDSSPSPLAASLGYPGGAPT--------PQQHSSTSS--VSPKTFHFEGLLTGNVQHSQLLLHAGSVSGAKVP---PLIREFVQSLDDKEWQSALFGLLQSQTYNQC--------------------EVDLFELL----------------CKVLDQNLFTQVDWARNSYYFKDLKV 305          
BLAST of EMLSAG00000008902 vs. Select Arthropod Genomes
Match: AFH04495.1 (ftz transcription factor 1, isoform C [Drosophila melanogaster])

HSP 1 Score: 255.373 bits (651), Expect = 6.468e-75
Identity = 130/198 (65.66%), Postives = 143/198 (72.22%), Query Frame = 0
Query:  177 DSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGV--SMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPV 372
            D K   EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA+RSC IDKTQRKRCPYCRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQV+RQRQ+    +  SMGP  +  T  +     +Y              P+MN                 IKQEIQIPQV+S+T SPD+SPSP+
Sbjct:  275 DFKHLFEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQVMRQRQLALQALRNSMGP-DIKPTPISPGYQQAY--------------PNMN-----------------IKQEIQIPQVSSLTQSPDSSPSPI 440          

HSP 2 Score: 112.079 bits (279), Expect = 4.647e-25
Identity = 44/68 (64.71%), Postives = 61/68 (89.71%), Query Frame = 0
Query:  428 KMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            ++  +IREF+ S+DDREWQ++L+ LLQ Q++NQVEVDLFEL+CKVLD NLF+QVDWARN+ +F++LK+
Sbjct:  568 RVSPMIREFVQSIDDREWQTQLFALLQKQTYNQVEVDLFELMCKVLDQNLFSQVDWARNTVFFKDLKV 635          
BLAST of EMLSAG00000008902 vs. Select Arthropod Genomes
Match: AAN11667.1 (ftz transcription factor 1, isoform A [Drosophila melanogaster])

HSP 1 Score: 255.373 bits (651), Expect = 6.468e-75
Identity = 130/198 (65.66%), Postives = 143/198 (72.22%), Query Frame = 0
Query:  177 DSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGV--SMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPV 372
            D K   EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA+RSC IDKTQRKRCPYCRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQV+RQRQ+    +  SMGP  +  T  +     +Y              P+MN                 IKQEIQIPQV+S+T SPD+SPSP+
Sbjct:  275 DFKHLFEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQVMRQRQLALQALRNSMGP-DIKPTPISPGYQQAY--------------PNMN-----------------IKQEIQIPQVSSLTQSPDSSPSPI 440          

HSP 2 Score: 112.079 bits (279), Expect = 4.647e-25
Identity = 44/68 (64.71%), Postives = 61/68 (89.71%), Query Frame = 0
Query:  428 KMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            ++  +IREF+ S+DDREWQ++L+ LLQ Q++NQVEVDLFEL+CKVLD NLF+QVDWARN+ +F++LK+
Sbjct:  568 RVSPMIREFVQSIDDREWQTQLFALLQKQTYNQVEVDLFELMCKVLDQNLFSQVDWARNTVFFKDLKV 635          
BLAST of EMLSAG00000008902 vs. Select Arthropod Genomes
Match: ALI30486.1 (ftz transcription factor 1, isoform D [Drosophila melanogaster])

HSP 1 Score: 255.373 bits (651), Expect = 1.117e-74
Identity = 130/198 (65.66%), Postives = 143/198 (72.22%), Query Frame = 0
Query:  177 DSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGV--SMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPV 372
            D K   EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA+RSC IDKTQRKRCPYCRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQV+RQRQ+    +  SMGP  +  T  +     +Y              P+MN                 IKQEIQIPQV+S+T SPD+SPSP+
Sbjct:  275 DFKHLFEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQVMRQRQLALQALRNSMGP-DIKPTPISPGYQQAY--------------PNMN-----------------IKQEIQIPQVSSLTQSPDSSPSPI 440          

HSP 2 Score: 112.079 bits (279), Expect = 5.039e-25
Identity = 44/68 (64.71%), Postives = 61/68 (89.71%), Query Frame = 0
Query:  428 KMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            ++  +IREF+ S+DDREWQ++L+ LLQ Q++NQVEVDLFEL+CKVLD NLF+QVDWARN+ +F++LK+
Sbjct:  618 RVSPMIREFVQSIDDREWQTQLFALLQKQTYNQVEVDLFELMCKVLDQNLFSQVDWARNTVFFKDLKV 685          
BLAST of EMLSAG00000008902 vs. Select Arthropod Genomes
Match: AAF49231.2 (ftz transcription factor 1, isoform B [Drosophila melanogaster])

HSP 1 Score: 255.758 bits (652), Expect = 7.361e-74
Identity = 130/200 (65.00%), Postives = 144/200 (72.00%), Query Frame = 0
Query:  177 DSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGV--SMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHL 374
            D K   EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA+RSC IDKTQRKRCPYCRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQV+RQRQ+    +  SMGP  +  T  +     +Y              P+MN                 IKQEIQIPQV+S+T SPD+SPSP+ +
Sbjct:  499 DFKHLFEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQVMRQRQLALQALRNSMGP-DIKPTPISPGYQQAY--------------PNMN-----------------IKQEIQIPQVSSLTQSPDSSPSPIAI 666          

HSP 2 Score: 113.235 bits (282), Expect = 2.667e-25
Identity = 44/68 (64.71%), Postives = 61/68 (89.71%), Query Frame = 0
Query:  428 KMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            ++  +IREF+ S+DDREWQ++L+ LLQ Q++NQVEVDLFEL+CKVLD NLF+QVDWARN+ +F++LK+
Sbjct:  792 RVSPMIREFVQSIDDREWQTQLFALLQKQTYNQVEVDLFELMCKVLDQNLFSQVDWARNTVFFKDLKV 859          
BLAST of EMLSAG00000008902 vs. Select Arthropod Genomes
Match: EAA11812.4 (AGAP005661-PB [Anopheles gambiae str. PEST])

HSP 1 Score: 238.81 bits (608), Expect = 1.967e-69
Identity = 120/189 (63.49%), Postives = 130/189 (68.78%), Query Frame = 0
Query:  172 QSDQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPIT--HIKQEIQIPQV 358
            Q DQ D K  +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA+R C IDKTQRKRCPYCRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQ++RQRQ+    +           T  S   S               P +   +       Y  P +  HIKQEIQIPQV
Sbjct:  191 QCDQTDLKYFIEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERQCHIDKTQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQIMRQRQLALQALRGSIGGGVGIGTLGSDGVS---------------PQLQGLD-------YHQPYSSMHIKQEIQIPQV 357          

HSP 2 Score: 110.538 bits (275), Expect = 1.326e-24
Identity = 45/64 (70.31%), Postives = 58/64 (90.62%), Query Frame = 0
Query:  432 IIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            +IREF+ S+DDREWQ+ L+ LLQSQS+NQ EVDLFEL+CKVLD NLF+QVDWARN+ +F++LK+
Sbjct:  485 MIREFVQSIDDREWQTSLFSLLQSQSYNQCEVDLFELMCKVLDQNLFSQVDWARNTIFFKDLKV 548          
BLAST of EMLSAG00000008902 vs. nr
Match: gi|657600388|gb|AID52855.1| (fushi-tarazu transcription factor 1 [Tigriopus japonicus])

HSP 1 Score: 429.098 bits (1102), Expect = 2.532e-140
Identity = 236/345 (68.41%), Postives = 260/345 (75.36%), Query Frame = 0
Query:  164 DFGPGVVGQSDQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMIS----NPGGNPMGGDTPGSNPIIAQQTDPA-GGIQWQINA---AGKH-----QDIQSNQGTGKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            +FG GV GQSDQPD+KDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQV+H          ++T      + SY GGASG  NST +P             +Y S + HIKQEIQIPQVTSMTSSPD+SPSPV LP  I+            G +     IIA   DP+ G +QWQI+    +GK               GK+P +IREFL+SLDD+EWQ+ELYKLLQ+QSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYF+ELK+
Sbjct:  174 EFGGGV-GQSDQPDTKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVLH----------HHTGALGGVTLSY-GGASGLSNSTANP-------------MYSSQL-HIKQEIQIPQVTSMTSSPDSSPSPVQLPHSITLASGGGASGSGAGSSSQGGQIIAHHNDPSTGNLQWQISTSPQSGKDFPFVGSSGSGGGSNGKVPPLIREFLSSLDDKEWQAELYKLLQNQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFKELKV 492          
BLAST of EMLSAG00000008902 vs. nr
Match: gi|1130231467|ref|XP_019760699.1| (PREDICTED: nuclear hormone receptor FTZ-F1 isoform X3 [Dendroctonus ponderosae])

HSP 1 Score: 342.043 bits (876), Expect = 1.258e-107
Identity = 201/408 (49.26%), Postives = 253/408 (62.01%), Query Frame = 0
Query:  113 NNSPPTLSYSTSPTHNMLGLLPDNNSCNLFNPSAGLPTASSNNNSAGSTSGDFGPGV--------VGQSDQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPMGGDTPGSNPIIAQQTDPAG--GIQWQINAAG---------------KHQDIQSNQGTGKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            N+S PTLS  TS     L +  DN    +  P + +PT ++  ++ G    + GP          +   +  D+K+G+EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADR+C IDKTQRKRCP+CRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQ+LRQRQ+                                  S  S   M +N    SP  +GS   HIKQEIQIPQV+S+TSSPD+SPSP+ +     N     + G+TP +  I+   + P     I  ++  A                +   +  N    K+  +IR+F+ ++DDREWQ+ LY LLQ+Q++NQ EVDLFEL+CKVLD NLF+QVDWARNS +F++LK+
Sbjct:   22 NSSTPTLSVVTSEAD--LEINADNEIAEMPVPFSEIPTTNAGTHTLGGI--EMGPSFQISGPASSISGGEISDTKEGIEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRNCHIDKTQRKRCPFCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQLLRQRQL---------------------------AVQTLQGSQVSSNVMYSNQPGTSP--FGS--LHIKQEIQIPQVSSLTSSPDSSPSPIAVALGQVNSQMQQLSGNTPSTLQIVGVPSGPTQNPSIDQKLWGAANSTTTSPHSLSPKSFQFNSMAPNVPQNKVSPMIRDFVQAVDDREWQNSLYNLLQNQTYNQCEVDLFELMCKVLDQNLFSQVDWARNSIFFKDLKV 394          
BLAST of EMLSAG00000008902 vs. nr
Match: gi|926622047|ref|XP_013776390.1| (PREDICTED: nuclear hormone receptor FTZ-F1-like [Limulus polyphemus])

HSP 1 Score: 336.65 bits (862), Expect = 2.559e-106
Identity = 189/379 (49.87%), Postives = 231/379 (60.95%), Query Frame = 0
Query:  135 DNNSCNLFNPSAGLPTASSNNNSAGSTSGDFGPGVVGQSDQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQE-IQIPQVTSMTSSPDTSPSP----------------VHLPGMISNPGGNPMGGDTPGSNPIIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLAS-LDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            DN++C +    AG P+   NN++  +      P      D PD+K+G+EELCPVCGDKVSGYHYG+LTCESCKGFFKRTVQNKKVYTCVADR+C+IDKTQRKRCPYCRFQKCLDVGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQ+LRQ+QV+H      P  M ++        S   GA                     P +Y   +T +KQE IQIP ++S TSSPD+S S                 +H P     P     G  T G  P++                           G   +P +IREF  S +DD++WQ  L+ LLQSQ++NQ EVDLFEL+CKV+D +LFAQVDWARN+ +FR+LK+
Sbjct:    8 DNSACYI----AGGPSVVLNNSAPSTLPAPVAPSGQFPYDPPDTKEGIEELCPVCGDKVSGYHYGILTCESCKGFFKRTVQNKKVYTCVADRNCLIDKTQRKRCPYCRFQKCLDVGMKLEAVRPDRMRGGRNKFGPMYKRDRARKLQLLRQKQVVHTQCLSSPQEMGSSNPFLPPVVSVTTGA---------------------PPMYSPDLTQVKQELIQIPHLSSSTSSPDSSSSLPTTTQPHPTTSPPNPIIHHPTYSPKPYQCDPGPSTAGPVPLVT--------------------------GGSNIPDLIREFQTSFVDDKDWQGHLFNLLQSQTYNQCEVDLFELMCKVIDQSLFAQVDWARNTIFFRDLKV 335          
BLAST of EMLSAG00000008902 vs. nr
Match: gi|1058064643|gb|JAS35983.1| (hypothetical protein g.26897 [Clastoptera arizonana])

HSP 1 Score: 337.035 bits (863), Expect = 2.787e-106
Identity = 189/352 (53.69%), Postives = 225/352 (63.92%), Query Frame = 0
Query:  174 DQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPM---GGDTPGSNPIIAQQTDPAGGIQWQINAAGKHQDI---------------------------QSNQGTGKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            D PD+K+ +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSC IDKTQRKRCPYCRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQ++RQRQ+    +   P               Y     G +  +  P S +   N            HIKQEIQIPQV+S+TSSPD+SPS + +    +  G   +   GG TP S     Q        Q Q++    H  +                            S+  T KMP +IR+F+ S+DDREWQ  LY+LLQ+Q++NQ EVDLFEL+CKVLD NLF+QVDWARNS +F++LK+
Sbjct:   68 DLPDTKECIEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCHIDKTQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQMMRQRQMAVQTIRGSP---------------YATLGDGAVTLSYQPGSSSPFAN-----------LHIKQEIQIPQVSSLTSSPDSSPSSIAVAFGQAGLGSMVVCSTGGGTPSSQQPALQVAASGTTSQPQVSTL-DHAKLNWGAPNSTTPSPSSHSISPKTFQFDGGSSSTATTKMPPLIRDFVQSVDDREWQKSLYELLQNQTYNQCEVDLFELMCKVLDQNLFSQVDWARNSVFFKDLKV 392          
BLAST of EMLSAG00000008902 vs. nr
Match: gi|939264557|ref|XP_014252284.1| (PREDICTED: nuclear hormone receptor FTZ-F1 isoform X5 [Cimex lectularius] >gi|939264559|ref|XP_014252285.1| PREDICTED: nuclear hormone receptor FTZ-F1 isoform X5 [Cimex lectularius] >gi|939264561|ref|XP_014252286.1| PREDICTED: nuclear hormone receptor FTZ-F1 isoform X5 [Cimex lectularius])

HSP 1 Score: 336.65 bits (862), Expect = 3.203e-106
Identity = 191/345 (55.36%), Postives = 228/345 (66.09%), Query Frame = 0
Query:  173 SDQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLP------GMISNPGGNPMGGDTPGSNPIIAQQTDPAGGIQWQINAAGKHQDIQSNQGT-----------------GKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELK 494
            SD PD+K+G+EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA+RSC IDKTQRKRCP+CRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQ++RQRQ+                 T  +S+ Y  G  G   +    P  N          + S   HIKQEIQIPQV+S+TSSP++SPSP+ +       G ISN   N M    PGS    A Q      I  Q   A +H  + S   +                  K+  +IR+F+ ++DD EWQ+ LY LLQ+Q++NQ EVDLFEL+CKVLD NLF+QVDWARNS +F++LK
Sbjct:   23 SDMPDTKEGIEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPFCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQMMRQRQL--------------AAQTLRNSSGYSPGGLGDAVTLSYQPGSN----------FAS--LHIKQEIQIPQVSSLTSSPESSPSPIAVALGQAANGNISN---NNMCSVMPGSQTQPALQIVNDQRISHQSVQAFEHAKLWSGNTSPPPSKTFQYEGSSSQSQSKVSPMIRDFVQAIDDHEWQNSLYNLLQNQTYNQCEVDLFELMCKVLDQNLFSQVDWARNSVFFKDLK 338          
BLAST of EMLSAG00000008902 vs. nr
Match: gi|939264555|ref|XP_014252283.1| (PREDICTED: nuclear hormone receptor FTZ-F1 isoform X4 [Cimex lectularius])

HSP 1 Score: 337.806 bits (865), Expect = 4.194e-106
Identity = 191/345 (55.36%), Postives = 228/345 (66.09%), Query Frame = 0
Query:  173 SDQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLP------GMISNPGGNPMGGDTPGSNPIIAQQTDPAGGIQWQINAAGKHQDIQSNQGT-----------------GKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELK 494
            SD PD+K+G+EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA+RSC IDKTQRKRCP+CRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQ++RQRQ+                 T  +S+ Y  G  G   +    P  N          + S   HIKQEIQIPQV+S+TSSP++SPSP+ +       G ISN   N M    PGS    A Q      I  Q   A +H  + S   +                  K+  +IR+F+ ++DD EWQ+ LY LLQ+Q++NQ EVDLFEL+CKVLD NLF+QVDWARNS +F++LK
Sbjct:   72 SDMPDTKEGIEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPFCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQMMRQRQL--------------AAQTLRNSSGYSPGGLGDAVTLSYQPGSN----------FAS--LHIKQEIQIPQVSSLTSSPESSPSPIAVALGQAANGNISN---NNMCSVMPGSQTQPALQIVNDQRISHQSVQAFEHAKLWSGNTSPPPSKTFQYEGSSSQSQSKVSPMIRDFVQAIDDHEWQNSLYNLLQNQTYNQCEVDLFELMCKVLDQNLFSQVDWARNSVFFKDLK 387          
BLAST of EMLSAG00000008902 vs. nr
Match: gi|939264553|ref|XP_014252282.1| (PREDICTED: nuclear hormone receptor FTZ-F1 isoform X3 [Cimex lectularius])

HSP 1 Score: 337.806 bits (865), Expect = 5.672e-106
Identity = 191/345 (55.36%), Postives = 228/345 (66.09%), Query Frame = 0
Query:  173 SDQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLP------GMISNPGGNPMGGDTPGSNPIIAQQTDPAGGIQWQINAAGKHQDIQSNQGT-----------------GKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELK 494
            SD PD+K+G+EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA+RSC IDKTQRKRCP+CRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQ++RQRQ+                 T  +S+ Y  G  G   +    P  N          + S   HIKQEIQIPQV+S+TSSP++SPSP+ +       G ISN   N M    PGS    A Q      I  Q   A +H  + S   +                  K+  +IR+F+ ++DD EWQ+ LY LLQ+Q++NQ EVDLFEL+CKVLD NLF+QVDWARNS +F++LK
Sbjct:   86 SDMPDTKEGIEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPFCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQMMRQRQL--------------AAQTLRNSSGYSPGGLGDAVTLSYQPGSN----------FAS--LHIKQEIQIPQVSSLTSSPESSPSPIAVALGQAANGNISN---NNMCSVMPGSQTQPALQIVNDQRISHQSVQAFEHAKLWSGNTSPPPSKTFQYEGSSSQSQSKVSPMIRDFVQAIDDHEWQNSLYNLLQNQTYNQCEVDLFELMCKVLDQNLFSQVDWARNSVFFKDLK 401          
BLAST of EMLSAG00000008902 vs. nr
Match: gi|1058012244|gb|JAS09806.1| (hypothetical protein g.26896 [Clastoptera arizonana])

HSP 1 Score: 336.265 bits (861), Expect = 6.894e-106
Identity = 190/354 (53.67%), Postives = 225/354 (63.56%), Query Frame = 0
Query:  174 DQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPIT--HIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPM---GGDTPGSNPIIAQQTDPAGGIQWQINAAGKHQDI---------------------------QSNQGTGKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            D PD+K+ +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSC IDKTQRKRCPYCRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQ++RQRQ+    +   P               Y     G +  +  P S              SP    HIKQEIQIPQV+S+TSSPD+SPS + +    +  G   +   GG TP S     Q        Q Q++    H  +                            S+  T KMP +IR+F+ S+DDREWQ  LY+LLQ+Q++NQ EVDLFEL+CKVLD NLF+QVDWARNS +F++LK+
Sbjct:   82 DLPDTKECIEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCHIDKTQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQMMRQRQMAVQTIRGSP---------------YATLGDGAVTLSYQPGS-------------SSPFANLHIKQEIQIPQVSSLTSSPDSSPSSIAVAFGQAGLGSMVVCSTGGGTPSSQQPALQVAASGTTSQPQVSTL-DHAKLNWGAPNSTTPSPSSHSISPKTFQFDGGSSSTATTKMPPLIRDFVQSVDDREWQKSLYELLQNQTYNQCEVDLFELMCKVLDQNLFSQVDWARNSVFFKDLKV 406          
BLAST of EMLSAG00000008902 vs. nr
Match: gi|1009408543|gb|KYN27877.1| (Nuclear hormone receptor FTZ-F1 [Trachymyrmex cornetzi])

HSP 1 Score: 342.813 bits (878), Expect = 9.204e-106
Identity = 200/413 (48.43%), Postives = 240/413 (58.11%), Query Frame = 0
Query:  138 SCNLFNPSAGLPTASSNNNSAGSTSGDFG----PGVVGQ-----------SDQPDSKDGM-EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPV---------------HL----PGMIS--------NPGGN----------PMGGDTP--GSNPIIAQQTDPAGGIQWQINAAGKHQDIQSNQGTGKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            SC +   ++     ++ N +AG+     G    PG+ GQ           SD PD+KD + EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVA+RSC IDKTQRKRCPYCRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQ++RQRQ+                            A   +  +   P        NS S   +P+ HIKQEIQIPQV+S+TSSPD+                    HL    PG+ S         PG            P GG  P   SNP++A +T                           +  +IREFL+S+DDREWQ+ L+ LLQSQ++NQ EVDLFEL+CKVLD NLF+QVDWARNS +F++LK+
Sbjct:  232 SCKILAYNSNYEHITAGNVAAGAVPTGVGTLCHPGL-GQVGIVTGSIPCPSDFPDTKDIIIEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQLIRQRQL----------------------------AIQTIRGSLGDP--------NSYSTAVAPLMHIKQEIQIPQVSSLTSSPDSIGGGGGGGGGGGGGGGGGGNHLHNLNPGLDSRLWAANSTTPGTKVFNFGEQSVQPHGGGVPSYASNPVVALKT---------------------------LSPMIREFLSSIDDREWQTSLFGLLQSQTYNQCEVDLFELMCKVLDQNLFSQVDWARNSTFFKDLKV 580          
BLAST of EMLSAG00000008902 vs. nr
Match: gi|1058045879|gb|JAS26601.1| (hypothetical protein g.26895 [Clastoptera arizonana])

HSP 1 Score: 336.65 bits (862), Expect = 1.125e-105
Identity = 189/352 (53.69%), Postives = 225/352 (63.92%), Query Frame = 0
Query:  174 DQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVIHGGVSMGPSSMNNTXTTTSSSASYGGGASGGMNSTXSPPSMNNNNNNNSPSIYGSPITHIKQEIQIPQVTSMTSSPDTSPSPVHLPGMISNPGGNPM---GGDTPGSNPIIAQQTDPAGGIQWQINAAGKHQDI---------------------------QSNQGTGKMPAIIREFLASLDDREWQSELYKLLQSQSFNQVEVDLFELLCKVLDHNLFAQVDWARNSYYFRELKI 495
            D PD+K+ +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSC IDKTQRKRCPYCRFQKCL+VGMKLEAVR DRMRGGRNKFGPMYKRDRARKLQ++RQRQ+    +   P               Y     G +  +  P S +   N            HIKQEIQIPQV+S+TSSPD+SPS + +    +  G   +   GG TP S     Q        Q Q++    H  +                            S+  T KMP +IR+F+ S+DDREWQ  LY+LLQ+Q++NQ EVDLFEL+CKVLD NLF+QVDWARNS +F++LK+
Sbjct:   68 DLPDTKECIEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCHIDKTQRKRCPYCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQMMRQRQMAVQTIRGSP---------------YATLGDGAVTLSYQPGSSSPFAN-----------LHIKQEIQIPQVSSLTSSPDSSPSSIAVAFGQAGLGSMVVCSTGGGTPSSQQPALQVAASGTTSQPQVSTL-DHAKLNWGAPNSTTPSPSSHSISPKTFQFDGGSSSTATTKMPPLIRDFVQSVDDREWQKSLYELLQNQTYNQCEVDLFELMCKVLDQNLFSQVDWARNSVFFKDLKV 392          
BLAST of EMLSAG00000008902 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold1034_size68570-processed-gene-0.12 (protein:Tk10487 transcript:snap_masked-scaffold1034_size68570-processed-gene-0.12-mRNA-1 annotation:"hypothetical protein YQE_06807 partial")

HSP 1 Score: 202.986 bits (515), Expect = 2.775e-62
Identity = 131/220 (59.55%), Postives = 145/220 (65.91%), Query Frame = 0
Query:   69 LLPTMDMPI---GNSF-ASLEDLSSVVHPLGLG----------------GGGPG--------SGGNPVDSGSNNSPPTLSYSTSPTHNMLGLLPDNNSCNLFNPSAGLPTASSNN-----NSAGSTSGDFGPGVVGQSDQPDSKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEA 255
            +LPTM++PI   G  F   LEDL+ V HP  +G                  G G        SG   V S +NN+   LS S++ +    GL+ D  SC LF  +AG    S  N     NSA S S +FG GV GQSDQPD+KDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEA
Sbjct:    1 MLPTMELPISSAGGGFNVGLEDLNGV-HPSQIGLQSSSSSSVGGTSSLVTAGVGDLSQYMGNSGTGSVGSNNNNNNTMLSISSAVS----GLMGDA-SC-LFAGAAGSNQVSGGNGGPSSNSAMSPS-EFGGGV-GQSDQPDTKDGMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEA 211          
BLAST of EMLSAG00000008902 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold491_size156641-snap-gene-0.24 (protein:Tk05482 transcript:maker-scaffold491_size156641-snap-gene-0.24-mRNA-1 annotation:"orphan nuclear receptor")

HSP 1 Score: 135.576 bits (340), Expect = 2.923e-34
Identity = 61/96 (63.54%), Postives = 71/96 (73.96%), Query Frame = 0
Query:  180 DGMEE---LCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMY 272
            D +EE   +C +C DK +G HYG++TCE CKGFFKRTVQNK++Y CVAD  C I+K QR RC YCRFQKCL  GM L AVR DRM GGRN  G +Y
Sbjct:  186 DHIEEESLICMICEDKATGLHYGIITCEGCKGFFKRTVQNKRIYNCVADGHCEINKAQRNRCQYCRFQKCLHKGMVLAAVREDRMPGGRNS-GAVY 280          
BLAST of EMLSAG00000008902 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1296_size49803-snap-gene-0.14 (protein:Tk08819 transcript:maker-scaffold1296_size49803-snap-gene-0.14-mRNA-1 annotation:"nuclear hormone receptor ftz-f1 beta")

HSP 1 Score: 137.117 bits (344), Expect = 3.194e-34
Identity = 56/87 (64.37%), Postives = 65/87 (74.71%), Query Frame = 0
Query:  186 CPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMY 272
            CPVCGDK+SG+HYG+ +CESCKGFFKRTVQNKK Y C+    C I    RK+CP CRF KCL  GMKLEA+R DR RGGR+ +   Y
Sbjct:  633 CPVCGDKISGFHYGIFSCESCKGFFKRTVQNKKNYVCLRGAQCPITIATRKKCPACRFDKCLKTGMKLEAIREDRTRGGRSTYQCSY 719          
BLAST of EMLSAG00000008902 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold421_size176100-snap-gene-0.27 (protein:Tk10558 transcript:maker-scaffold421_size176100-snap-gene-0.27-mRNA-1 annotation:"estrogen related nuclear partial")

HSP 1 Score: 112.849 bits (281), Expect = 1.373e-29
Identity = 54/107 (50.47%), Postives = 68/107 (63.55%), Query Frame = 0
Query:  188 VCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDR-----ARKLQVLRQRQVI 289
            VCGD  SG+HYG+ +CE+CK FFKRT+Q    YTC A   C I+K +RK C  CRFQKCL +GM  E VR DR+RGGR K+  M +        ARKL +   + +I
Sbjct:    2 VCGDVASGFHYGVSSCEACKAFFKRTIQGNIEYTCPASNECEINKRRRKACQACRFQKCLRMGMLKEGVRLDRVRGGRQKYRRMIESPYGGLHPARKLSLEENKLLI 108          
BLAST of EMLSAG00000008902 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold192_size271026-snap-gene-1.22 (protein:Tk07205 transcript:maker-scaffold192_size271026-snap-gene-1.22-mRNA-1 annotation:"retinoid x receptor")

HSP 1 Score: 118.627 bits (296), Expect = 3.293e-29
Identity = 47/84 (55.95%), Postives = 62/84 (73.81%), Query Frame = 0
Query:  181 GMEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGG 264
            G +  C +CGD+ SG HYG+ +CE CKGFFKRTV+ + VY C  +++C+IDK QR RC YCR+ KCL  GM+ EAV+ +R RGG
Sbjct:   63 GSKHFCSICGDRASGKHYGVYSCEGCKGFFKRTVRKELVYACRENKACIIDKRQRNRCQYCRYMKCLATGMRREAVQEERNRGG 146          
BLAST of EMLSAG00000008902 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold743_size103610-snap-gene-0.17 (protein:Tk01116 transcript:maker-scaffold743_size103610-snap-gene-0.17-mRNA-1 annotation:"probable nuclear hormone receptor hr38-like")

HSP 1 Score: 114.005 bits (284), Expect = 6.873e-28
Identity = 48/84 (57.14%), Postives = 59/84 (70.24%), Query Frame = 0
Query:  185 LCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKF 268
            LC VCGD  +  HYG+ TCE CKGFFKRTVQ    Y C+AD++C +DK +R RC +CRFQKCL VGM  E VR D ++G R + 
Sbjct:   30 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRL 113          
BLAST of EMLSAG00000008902 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1408_size42850-snap-gene-0.13 (protein:Tk00739 transcript:maker-scaffold1408_size42850-snap-gene-0.13-mRNA-1 annotation:"probable nuclear hormone receptor hr38-like")

HSP 1 Score: 114.005 bits (284), Expect = 6.873e-28
Identity = 48/84 (57.14%), Postives = 59/84 (70.24%), Query Frame = 0
Query:  185 LCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKF 268
            LC VCGD  +  HYG+ TCE CKGFFKRTVQ    Y C+AD++C +DK +R RC +CRFQKCL VGM  E VR D ++G R + 
Sbjct:   30 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLADKNCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRL 113          
BLAST of EMLSAG00000008902 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold329_size204955-snap-gene-0.15 (protein:Tk00268 transcript:maker-scaffold329_size204955-snap-gene-0.15-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_311954")

HSP 1 Score: 104.76 bits (260), Expect = 1.279e-24
Identity = 46/104 (44.23%), Postives = 62/104 (59.62%), Query Frame = 0
Query:  186 CPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVI 289
            C VCGDK SG HYG++TCE CKGFF+R+  +   Y C   ++C +D+  R RC YCR QKCL++GM  +AV          KFG M K+ R +    +R  + I
Sbjct:   45 CKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVINYQCPRQKNCTVDRVNRNRCQYCRLQKCLNLGMSRDAV----------KFGRMSKKQREKVEDEVRYHKEI 138          
BLAST of EMLSAG00000008902 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1331_size47282-snap-gene-0.8 (protein:Tk00449 transcript:maker-scaffold1331_size47282-snap-gene-0.8-mRNA-1 annotation:"hormone receptor")

HSP 1 Score: 105.916 bits (263), Expect = 2.935e-24
Identity = 46/104 (44.23%), Postives = 62/104 (59.62%), Query Frame = 0
Query:  186 CPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGPMYKRDRARKLQVLRQRQVI 289
            C VCGDK SG HYG++TCE CKGFF+R+  +   Y C   ++C +D+  R RC YCR QKCL++GM  +AV          KFG M K+ R +    +R  + I
Sbjct:   74 CKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVINYQCPRQKNCTVDRVNRNRCQYCRLQKCLNLGMSRDAV----------KFGRMSKKQREKVEDEVRYHKEI 167          
BLAST of EMLSAG00000008902 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1013_size70870-snap-gene-0.16 (protein:Tk07036 transcript:maker-scaffold1013_size70870-snap-gene-0.16-mRNA-1 annotation:"transcription factor hnf-4 homolog")

HSP 1 Score: 101.679 bits (252), Expect = 5.451e-23
Identity = 38/85 (44.71%), Postives = 57/85 (67.06%), Query Frame = 0
Query:  186 CPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVADRSCVIDKTQRKRCPYCRFQKCLDVGMKLEAVRHDRMRGGRNKFGP 270
            C +CGDK +G HYG  +C+ CKGFF+R+V+ K+ Y C   R+CV+ K +R +C +CR +KC+  GMK ++V+H R R    +  P
Sbjct:  200 CAICGDKATGKHYGAASCDGCKGFFRRSVRKKQAYICRFYRNCVVTKDKRNQCRFCRLRKCMKAGMKTDSVQHTRDRISSKRSTP 284          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000008902 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-8.451e-7365.00symbol:ftz-f1 "ftz transcription factor 1" species... [more]
-2.512e-6842.90symbol:NR5A2 "Nuclear receptor subfamily 5 group A... [more]
-3.089e-6842.51symbol:NR5A2 "cDNA, FLJ79412, highly similar to Or... [more]
-4.166e-6842.90symbol:NR5A2 "Nuclear receptor subfamily 5 group A... [more]
-7.700e-6842.50symbol:Nr5a2 "nuclear receptor subfamily 5, group ... [more]
-1.713e-6742.51symbol:NR5A2 "Nuclear receptor subfamily 5 group A... [more]
-3.270e-6742.60symbol:NR5A2 "Nuclear receptor subfamily 5 group A... [more]
-1.068e-6640.57symbol:NR5A2 "Uncharacterized protein" species:961... [more]
-2.969e-6641.80symbol:Nr5a2 "Nuclear receptor subfamily 5 group A... [more]
-2.969e-6641.80symbol:Nr5a2 "nuclear receptor subfamily 5, group ... [more]

Pages

back to top
BLAST of EMLSAG00000008902 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592832455|gb|GAXK01125089.1|2.050e-11257.18TSA: Calanus finmarchicus comp25625_c0_seq1 transc... [more]
gi|592829906|gb|GAXK01127638.1|6.178e-3259.05TSA: Calanus finmarchicus comp171820_c0_seq3 trans... [more]
gi|592829908|gb|GAXK01127636.1|6.317e-3259.05TSA: Calanus finmarchicus comp171820_c0_seq1 trans... [more]
gi|592829905|gb|GAXK01127639.1|6.386e-3259.05TSA: Calanus finmarchicus comp171820_c0_seq4 trans... [more]
gi|592829907|gb|GAXK01127637.1|6.531e-3259.05TSA: Calanus finmarchicus comp171820_c0_seq2 trans... [more]
gi|592874024|gb|GAXK01083538.1|1.551e-3163.86TSA: Calanus finmarchicus comp176096_c4_seq1 trans... [more]
gi|592878692|gb|GAXK01079209.1|1.342e-2755.32TSA: Calanus finmarchicus comp267685_c0_seq1 trans... [more]
gi|592874034|gb|GAXK01083528.1|4.707e-2762.67TSA: Calanus finmarchicus comp176096_c2_seq9 trans... [more]
gi|592874035|gb|GAXK01083527.1|4.707e-2762.67TSA: Calanus finmarchicus comp176096_c2_seq8 trans... [more]
gi|592793189|gb|GAXK01161379.1|5.151e-2654.12TSA: Calanus finmarchicus comp35375_c1_seq3 transc... [more]

Pages

back to top
BLAST of EMLSAG00000008902 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 22
Match NameE-valueIdentityDescription
EMLSAP000000089020.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s554:57230... [more]
EMLSAP000000044514.432e-3563.22pep:novel supercontig:LSalAtl2s:LSalAtl2s231:94591... [more]
EMLSAP000000019191.043e-2959.04pep:novel supercontig:LSalAtl2s:LSalAtl2s132:61643... [more]
EMLSAP000000130048.183e-2857.14pep:novel supercontig:LSalAtl2s:LSalAtl2s98:942409... [more]
EMLSAP000000080711.866e-2752.04pep:novel supercontig:LSalAtl2s:LSalAtl2s47:304551... [more]
EMLSAP000000099691.619e-2253.85pep:novel supercontig:LSalAtl2s:LSalAtl2s651:30270... [more]
EMLSAP000000073611.631e-2246.75pep:novel supercontig:LSalAtl2s:LSalAtl2s418:37435... [more]
EMLSAP000000078944.370e-2242.59pep:novel supercontig:LSalAtl2s:LSalAtl2s466:35137... [more]
EMLSAP000000099401.767e-2145.16pep:novel supercontig:LSalAtl2s:LSalAtl2s649:35313... [more]
EMLSAP000000124866.037e-2151.43pep:novel supercontig:LSalAtl2s:LSalAtl2s91:348479... [more]

Pages

back to top
BLAST of EMLSAG00000008902 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|44889025|sp|P49867.2|FTZF1_BOMMO1.875e-10553.67RecName: Full=Nuclear hormone receptor FTZ-F1; Alt... [more]
gi|45644987|sp|P33244.2|FTZF1_DROME1.519e-7365.00RecName: Full=Nuclear hormone receptor FTZ-F1; Alt... [more]
gi|7676159|sp|P45448.3|NR5A2_MOUSE4.504e-6942.50RecName: Full=Nuclear receptor subfamily 5 group A... [more]
gi|7676156|sp|O00482.2|NR5A2_HUMAN9.871e-6942.51RecName: Full=Nuclear receptor subfamily 5 group A... [more]
gi|3334187|sp|O42101.1|NR5A2_CHICK1.803e-6842.60RecName: Full=Nuclear receptor subfamily 5 group A... [more]
gi|81907060|sp|Q9QWM1.1|NR5A2_RAT1.833e-6741.80RecName: Full=Nuclear receptor subfamily 5 group A... [more]
gi|1703164|sp|P50569.1|STF1_RAT1.101e-5375.00RecName: Full=Steroidogenic factor 1; Short=SF-1; ... [more]
gi|341942103|sp|P33242.3|STF1_MOUSE1.136e-5375.00RecName: Full=Steroidogenic factor 1; Short=SF-1; ... [more]
gi|416584|sp|Q04752.1|STF1_BOVIN1.232e-5383.33RecName: Full=Steroidogenic factor 1; Short=SF-1; ... [more]
gi|160221327|sp|P79387.3|STF1_PIG1.366e-5383.33RecName: Full=Steroidogenic factor 1; Short=SF-1; ... [more]

Pages

back to top
BLAST of EMLSAG00000008902 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
gb|KYB28389.1|5.541e-10650.72ftz transcription factor 1 [Tribolium castaneum][more]
gb|EFA01263.2|7.139e-10650.72ftz transcription factor 1 [Tribolium castaneum][more]
XP_006557455.13.155e-10254.26PREDICTED: nuclear hormone receptor FTZ-F1 [Apis m... [more]
gb|KPM05140.1|1.625e-9449.45nuclear hormone receptor FTZ-F1-like protein [Sarc... [more]
EFX77612.17.365e-8146.20hypothetical protein DAPPUDRAFT_305379 [Daphnia pu... [more]
AFH04495.16.468e-7565.66ftz transcription factor 1, isoform C [Drosophila ... [more]
AAN11667.16.468e-7565.66ftz transcription factor 1, isoform A [Drosophila ... [more]
ALI30486.11.117e-7465.66ftz transcription factor 1, isoform D [Drosophila ... [more]
AAF49231.27.361e-7465.00ftz transcription factor 1, isoform B [Drosophila ... [more]
EAA11812.41.967e-6963.49AGAP005661-PB [Anopheles gambiae str. PEST][more]

Pages

back to top
BLAST of EMLSAG00000008902 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|657600388|gb|AID52855.1|2.532e-14068.41fushi-tarazu transcription factor 1 [Tigriopus jap... [more]
gi|1130231467|ref|XP_019760699.1|1.258e-10749.26PREDICTED: nuclear hormone receptor FTZ-F1 isoform... [more]
gi|926622047|ref|XP_013776390.1|2.559e-10649.87PREDICTED: nuclear hormone receptor FTZ-F1-like [L... [more]
gi|1058064643|gb|JAS35983.1|2.787e-10653.69hypothetical protein g.26897 [Clastoptera arizonan... [more]
gi|939264557|ref|XP_014252284.1|3.203e-10655.36PREDICTED: nuclear hormone receptor FTZ-F1 isoform... [more]
gi|939264555|ref|XP_014252283.1|4.194e-10655.36PREDICTED: nuclear hormone receptor FTZ-F1 isoform... [more]
gi|939264553|ref|XP_014252282.1|5.672e-10655.36PREDICTED: nuclear hormone receptor FTZ-F1 isoform... [more]
gi|1058012244|gb|JAS09806.1|6.894e-10653.67hypothetical protein g.26896 [Clastoptera arizonan... [more]
gi|1009408543|gb|KYN27877.1|9.204e-10648.43Nuclear hormone receptor FTZ-F1 [Trachymyrmex corn... [more]
gi|1058045879|gb|JAS26601.1|1.125e-10553.69hypothetical protein g.26895 [Clastoptera arizonan... [more]

Pages

back to top
BLAST of EMLSAG00000008902 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 25
Match NameE-valueIdentityDescription
snap_masked-scaffold1034_size68570-processed-gene-0.122.775e-6259.55protein:Tk10487 transcript:snap_masked-scaffold103... [more]
maker-scaffold491_size156641-snap-gene-0.242.923e-3463.54protein:Tk05482 transcript:maker-scaffold491_size1... [more]
maker-scaffold1296_size49803-snap-gene-0.143.194e-3464.37protein:Tk08819 transcript:maker-scaffold1296_size... [more]
maker-scaffold421_size176100-snap-gene-0.271.373e-2950.47protein:Tk10558 transcript:maker-scaffold421_size1... [more]
maker-scaffold192_size271026-snap-gene-1.223.293e-2955.95protein:Tk07205 transcript:maker-scaffold192_size2... [more]
maker-scaffold743_size103610-snap-gene-0.176.873e-2857.14protein:Tk01116 transcript:maker-scaffold743_size1... [more]
maker-scaffold1408_size42850-snap-gene-0.136.873e-2857.14protein:Tk00739 transcript:maker-scaffold1408_size... [more]
maker-scaffold329_size204955-snap-gene-0.151.279e-2444.23protein:Tk00268 transcript:maker-scaffold329_size2... [more]
maker-scaffold1331_size47282-snap-gene-0.82.935e-2444.23protein:Tk00449 transcript:maker-scaffold1331_size... [more]
maker-scaffold1013_size70870-snap-gene-0.165.451e-2344.71protein:Tk07036 transcript:maker-scaffold1013_size... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s554supercontigLSalAtl2s554:572309..581835 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Biotypeprotein_coding
EvidenceIEA
NoteNuclear hormone receptor FTZ-F1
DescriptionPREDICTED: similar to ecdysone response nuclear receptor Ftz-F1
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000008902 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000008902EMLSAT00000008902-704749Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s554:572309..581835+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000008902-691668 ID=EMLSAG00000008902-691668|Name=EMLSAG00000008902|organism=Lepeophtheirus salmonis|type=gene|length=9527bp|location=Sequence derived from alignment at LSalAtl2s554:572309..581835+ (Lepeophtheirus salmonis)
CTGTGAACTCCCGTTTTTTTCATTTTATTTTTTTTAGTTATATGCTATTC TATCGATCTACTGCTGCTGATAGTAGACTTTTTGTACATACAAACAATTC GTTAGAGATTCGTGCAGATTTTTTTTTTGACTTGAAGGAAGATCCACAAA TATTTATTTATTACAACATATATTTAAAAAAGAAAAAAAGAGAAAAGAAA CGGAGAAACAGAGAAGGGAATAAATAAAGTAATTTTGACCTAGATATCGG TGTGTTTAACTCAATTTGATACTACTCTGATTATTATTGAATCTATCATG AAGTACGAAGTGAGACCCTAACTTATTTAATATATCTGCTGCGTCTTCTG CTATTACTTCAAGAACAACAACATCTTCAAACCGGTGAAGGAAACTCTAC ATATAAGAACGAAATCCACATTTTGTTAATTGAGGACAACAACGACGACT CTACTATACTCATTAGCTATACATTGTGTGGATTTCGAAAAGAGACGCGG ACGATAAGGAGCAGGGAATTTGTGATTTCGAAAAAAAAATAGTAAAAATG TGCCATGGTGGTTTGAGATGACCAAATACATTTATAAGGGCAAGTTACGT GAAAAAGGCCCTTGAATGTTACCCACGGAACCTCTTATTAGTATTCCGTA TTCTAACCAACGTGGACGTTTCCATCAACCCCATATTCAAGASCTGCCTC TCGCAGCCCCGGGTTCTAATCATAGATCATCATCCCTGATCCTTATAAAA AAAGAGCCGAATATGAGCACAAGTGGAAGCTTGAGTAGCGGTGGTAGTCC TCCCATGGTTGGAGGAACACTCCTCCCAACCATGGATATGCCGATCGGAA ACTCATTTGCTTCCTTGGAAGACCTGAGCAGTGTAGTCCATCCACTCGGC CTCGGAGGGGGTGGACCTGGGTCAGGAGGAAATCCTGTTGACTCCGGCTC TAATAACTCTCCCCCAACATTGTCGTATTCCACAAGTCCTACACACAACA TGCTAGGCCTCCTACCTGATAATAATTCCTGCAACCTTTTTAACCCTTCA GCAGGACTACCAACAGCATCCAGTAACAACAACTCCGCTGGATCCACATC CGGAGACTTCGGTCCTGGAGTTGTGGGTCAATCCGATCAACCGGATTCTA AAGACGGTATGGAAGAATTGTGCCCTGTTTGCGGGGATAAAGTCTCAGGA TATCACTATGGACTCCTCACCTGTGAGTCCTGTAAAGGATTCTTCAAACG AACGGTTCAGAATAAAAAAGTTTATACTTGCGTTGCGGATCGAAGCTGTG TCATCGATAAAACGCAACGGAAAAGATGCCCTTACTGCCGCTTTCAAAAG TGCTTAGATGTTGGAATGAAACTCGAAGGTAAGAAAAACTTCTTCTTCTT TTCTTTTTTTGAAAATATATTATGCTCTGATTTAAACATTATAACCAACC ATTTATTTGAATCAAAGTCTTCAATTCTTTGATCCTTGGTGTTTTTTTGT TTTTTTTGCTTGTTTTTCTTTTCTCTTCCCTTCCTATTTTTTTTCTATCA AAGAAGCAGAATCCCCCAAACGAGATCCATCTCAAAAGATTTACTAATAA GTGAACCTTTCTTAATCATGACTCATCCAAGCACACCAATAACCGGATAT TAAAATTCCACCATCTCTTTTTCCCTCTCTCCTCCTCCTCCTCCTGTTTC AAGTATGTCATGACGGATTTATAACGTTAGAAATATATCCTTTTCTCCTT TGTTAAAACTACTACTTCTTTGAGTCTATATACCTTAAGAAACAGTCCAT TGCGGAGAGAACTTTTTTTTTACTTGCATTGTGGTGTATATATATATATA TATAATTTCAGTACAGAAATATCATTGAGTAATTAGTTTCTTTTTATATA AAAAATCAAAATAGGGAATTAACTTCCAACTTTGGAGGGGTAGGTCACTT TAGGGGATGACCCAGAAAGAAGAAAATGATGATGCATTCAGGGTGGGTTT TTTTAAAGGTCGTTGCACTTTTTATGATGATTTTTATTATTTTCTACTGT AACAAAAAAAAAAACACACATTAAAAAACGTTTTTTCTTTTTAAAGAAAA AAAAAAAACGATCCAAAACCTTCCCCTGCTTCCTCCACCCCAAAATAGCT TGGAGAAAATTGTATTTTCTTTTTCTTCTTGGGTAGCTTGGTTTTTTATT ATTTTTCTTCCTTTAAATGACCCAAATTTTTAAAGGGAAGAACGACGAAG ACCTAGGGGGAAGGGGGAAAAAAAAGCATTATTCCACACATATATATAGC GTCAGTAGTATTTAAAGAAAGAAAAAAAGAACAAAGTCATGGTGAAAATC CTGGTGCAAGCCTTATTATATTTTTTCCCCGATTTTCAATTCATACAAAG AAATGGTTTTTTCCTTTTTTTCCCCTTCTTCCCAGTTACATATCCGCTTT GAAGCGCAAAAACGTGGAGTGTTTTTATTCATTAAATAATTTTTATTATT TAATCCAAATTCTTAATTATTTACAAATGAAAAACACCTATTAAGKAAGG CCCAAGAAAGCGGTGCTTAAGGTATATATTCTATACCCCCCCCCCATTTT GAAAGTATATAGGGGTCAAGGACGTTAGGGTGCAATTTTGGCGGGAATAG GGATGCTTATTTATTCAATGGATTCTTCTACTTTTTTTCCCGGGATGTTT GTCCTATTTCTTCTCCTTTATTGTTATGTCGTTGAGAATTGTTGCTTTTT TTCCCTGCTTTATATATTTAAGAAGAGGGGTGGGTGAGGGGTATGTAGTA ATAATAGGGGGGGGGGTATGAGGAAAGTAGAGCAGTCAATAGCACCACTT TTTGGGGGGGAGGGGGTAGACGAAGAAGAAGCACTTTACACAACGGCCTT GAAGGGAAAATATATATGTAGTAGGAGAGGAGGATGAGGTGGTGCATTAA TAGTACAAGTATGACTTACTAATAAGTCAGTCATAACTCACTCACTCACT CACTCATGTAAAGGAATTATTCTCATTGCACTAAGGCATATGCAATAGTT TTTAGGGGTGGGGTGGGGGGTTGAAAGCTCTCGAGTCATTATGAACCCCA GATTTGAGGACATGATTCGGCCCTAACTAATTGTCCATTGTATTCGACTC AAATGACTATTGCAAAAATAGCTATTTATCGTTACCATGTGCGACGACTC CTGCTGATGGTGGTGAGTTGGATAGAAAATATAAAAAAAAACGCGACCAA AAATAGAGAATAATAAAGTAGAGACGATGAGGACTACACGAAGAAGAAGC AGAGTTATTATACAAATAATAAAAAAATACGAAAAATAAAAGTGAAAGTA TAACTTACATACATAAAATAACTAAGTGTATATATTTATATATATATATT TTACGCCAAAATCCGAGCGCTCCCTCTTTTAATTTCTTCTGCTTATGAAA TCTCGTCTGTTAGGAGCGCGCCCTCCTTTTTTTTACATATATATATAAAT ATTATTTTATTCCCCTTCTTCGTCGTCTTTAGTATGTTTTAGAAACTAGG CCAAGGACGATTATGGGCCTACTCCTGATTGCAAATGAAGGAAGGAAATA ATATAATACGAGGGAATCCTCATATTATTGATATTCATAGATATATATAT ATATATAAATATCTTTGACAATAGTAGTATTTCTTGAGTTGGGTGGACGG AAATTGGGGTCAATGGTAGTATAGAGTTCTGCTGTCCCTATGGGCTATCT CTTACGACCCCTCTCTCATAGTCATCACTACTATGTACCTCCTCTCAAGT AATAAAATAAAATAAAAAACACTCACAAAAGAGAGGGATGAAAACAATGG GATATCCCAAGGTCATTGTAGGAAAAGAGAGAATAGGTCGTCGACCAACC CTAGGATTCAAGTGGTAGTAGTAGTAGTAGTAGTAATACTCAACCCTCCT CCACTTACAAAAGAAGACACAGAGAGAAAAGAGATTGACCTGAAAAGCAC AGGTTATCATCATCATCCTATTAGTTACTACATACTATCGTCATCCTCTT TCTTTCTGATGTCTCTTCATCTTATCTTTATACTACTAAGGGTGTATTTG AGCGATGCTATGACCTTCAATTCAACAAAGTTTCCTTTTTGTCTGTACAT ATATATATATATAGTYTGGGGGGGGGGGGKGATCTTGCGATTTCAGAGAG TGTATCCATATCAATTTGTATGCCTTCTTAATAAAGATATGATAGAACGA TGATATTTTTTTGTACATATGTAAGTAATGTAGGGAGATTTGTTTGCATG TCAAGTAGGACAGAAAGTAGATGATGGTTTAATAGATTTGAAATTAATCT TTATATATATATTTTTCAGCCGTTCGTCATGATCGAATGCGCGGAGGGAG GAACAAATTCGGGCCCATGTACAAACGTGATAGGGCACGGAAACTGCAAG TCTTGCGTCAAAGACAAGTGATACACGGTGGAGTTTCCATGGGCCCAAGT AGCATGAATAATACGMCAACCACAACGAGTAGTAGTGCATCCTACGGCGG CGGKGCCTCCGGTGGAATGAACTCCACGAGKAGCCCTCCATCCATGAACA ATAATAATAATAACAATTCCCCCTCAATCTACGGCTCACCCATCACTCAT ATTAAACAAGAGATACAAATACCACAAGTCACATCTATGACGTCTTCACC AGATACTTCACCCTCTCCCGTTCATTTACCCGGAATGATTTCTAATCCTG GAGGCAATCCAATGGGTGGAGATACTCCGGGCTCCAATCCCATCATTGCC CAACAGACTGATCCTGCCGGAGGTATTCAATGGCAGATCAATGCTGCTGG AAAGGTTTGTCATAAATACTCAATCAAAACAACACTCTATCATCATCTTC TTACTTTTCAGCATCAGGATATCCAAAGTAATCAAGGAACTGGGAAAATG CCAGCCATCATTCGAGAATTCCTTGCCTCCCTGGATGATCGGGAGTGGCA ATCCGAGTTATATAAATTACTACAGTCTCAGTCTTTTAACCAAGTAGAAG TTGACCTATTCGAATTGTTGTGTAAAGTTCTTGATCATAATCTCTTTGCT CAAGTGGATTGGGCTAGAAATTCATACTACTTCAGAGAACTCAAGGTATG AATAGAATCTTTATTTTTTTCACTCTTAAATTACCCCTCATTAGCTTTTA ATTATTAGAAGGAAATTCTTCTTACTCTGCAACCTCCTCTCCTTGCTCCT TGCTCCTTTATTCTTTAAACAATAAAATAGGGGAAAATATAATAATTATT AATGATGAATTATTCAAAATATATGTACACTACTTAGTTCTGTAGTGTAT ATAATATATATATATACNATTTTCTTGTCTCGACGTCTCCTTTTTTTCAC GATTTTTTTAAAAAGAAAAATTCTTCTTCTGAAATTAGTATTTTTTCACA AGGCCGTCTAGTATTCCTTCTATGTTTGGATTTTTTAATAATTTTATTTG CTTGCTCAGCTATTATTATTATTAATGATTTGATTGTTATTATTTTTTAA CAATAAAATACAATTTCAAGTATTTGAAGAGAAATTGAATAGCGGGAGAA GGAAAATTATATATATATATACATATATATATTTCTTCATTTACATCAAA TGAATCCTCATGGATTTTTCTCCCTTTGTACACAAACTAAATAATCACAC ATGATTATTTTTTTTAGTTGCCAAGTCAATTATTTTTGTACACATGGACT TACCATTAATAGTATTCTTACGTATTTCCCACCACCATCAACCTCATCTA CTTTCACCATGTGTGCTTCGAAGAGTGGCAGSRGCGCCYACTCTTTTYCT TCTTTYAAGCAAGTCATCTGGGKCATTGTCAAAAGAAAGAGCGCGCACTC TTTCTCTTTATGTGTATAATACCTATTATAGAAAGAATGAGATAGTTAAC GCGCGTGCATGCGCGCGCGCGTTAACTATCTACTTTCGCCAGGTACTAAT ATAAACGACGTAAAGTATGTACGATGATGATCATCACGGTGATGAGTATT CGTAGTACGGTGATTATGATGAGAGATATTCGTTCGTATTCCTCACTTAG TCTCTACTTTCGCTTTTTCTTAATACCATCATGGCCATATTGCGATATGT ATTACATACCTAGAAGATATTATATCTTGATGGCAGGRGCAGATTTTCCT TCTTTCTATATTTATTTTMCCTTCGTCTTGCTTAATATTCATTTCCCCCC TCCCCCCCCCTCTTCTTTTTTCCGAAACAAAAGGGTTATTTTGAAATATA TACTACAAAAGCGTAAAGGGATTTCGCAATATTTCTTTTCTAATTTTTTA TTTTTTTTTAAATGAACGACCTCGACGTGAAACCTTTTTATTTTATTTTT TGAATGATCATACATACATATACATATAATAATAACACTATGAACCCCTC TAATATTTTTCAAATATTTATTTTAAATATGAAAGGAACAAAATACGTCA CTTCTCCTCCTGCTGGGAGTTTAGTGTTATTAAGAGTCGTTCTCATAGAT TTGAGTAGTACATTATAGTAGTGTTTTATTTGTTTGACATAAATAAATAT ATCAAATCGACCACTCTGTTGACATTGACACACTTATCCTAATTAGAACA CACACTCATCTGCTACTGCTGATGGCGGCTTCCCTCCCAATATATATATA TAAGCTGTAGTTGTGGAGGTTCTTGATGATGTAAGGAACGTGTTATGACT TATGATTGATTCTCCCTCCCCTCTTTCTCTTTATAGAAAAGAAAAGTATT CGTCGTTGTCATAGCACACACAATATCTTTTGTTTGTTTTACTACTACGA ACGAAAAGGATGAGAAACAGAGTGTGGGAGAGACTGTAAAAATCGTCATT ATGATAATAATTGGAGAAATGACCTACTTTTAATAGCTTATCATCATATC ATTGTGTTTCTTAGTAGCTGCATTAATATGTTATTCATTATAGATATCAT TATAATATTTTCAATAACATGCAAAACTGTGCTTGCTGACCTCCTTTCTT TCCTCTCGCTTTTATAACACACTCTTGACCTATATATACATATTTGTCTT GGAAACAATCAAACATGATTAAGAGTGGAGTTGATTGCTGTTTGGAATGA AAGAACATACTAAAAGTGTTCAGCGCCAGTTTACTTTAATTAGTAGTGGG GATGTAAGCTACTTTCAATTTCAATATAAATTACATGCAGATATATATAT GATTCTATTCCAAGTAGCAGTCTCACCATTGCTTACCTCCCCCCCCCCCC CTTTAAATGTATGTGATGAAAGGAGAAAGCAGTAGGAGAGGGCAGTGTTG TAATATTATTTAGTGAAAGTAATATGTTTAGTAGAGAGAGAGAGAGATCT AACTGTTAAACAAAAGTGTTCAAAGATGGAGCTACTACTCGATTGCAATG ACCTACTTTTCGGGGTTCTCTCATATTTGTTGTATGTATATCATTTTCCC CCTTGTTTCACTTTCGTTAGTTGGAGTACTAATAAGAATATATATGTTTT ACAAAGAGCCTGCTTTCTTTCCCCTACTTTGCTAATCAATTGAAAATAAA CTTACAGACTACAACTATATTGAATAGTTATATGTTCATTCAAATCACCT CAAATCGATTTCAACACCTCAAAAATGCATTTAATTGCTTTTTGCATCTG TATGTCATTGTACAAACTACTTCAAAGTTGTAGATGAAATCCCCACCAGG GGGATTCCTGTTGTTTTTGTCAATAAGAAAAAGTTATTTTCTATTTTCGA ATTCGTTTTTTAAATGTATTTTATTAAGTTTGCGGAGAGGACCACTACGG TCGTGTCCGCAAGAATGTTGCTACTCTTGATTTGTTTTTGACAGATGGGA TGTTCTGTCAGTACAGTCTTATGACCGGTACTTGGGAGGACTGTCTGTAT TATTTTTAGAAAGGATATGCAAGACTGAATTGGAGTGAACTGTAGTAGGT AGGACGTCTTTTGGTATTTAAGTAAATGGTCAGAATAAATCAATTGCCCG TAAAGCTTTTGGAAGGGTGTTGTACTTCATAATGGAGAATTTAGGTACAC ATAACTATTTTAGCAGTTTAAACAATGTTTGTAAAGTATATCAAGAATGT TCCTTTACATTTTTCACCATCAAAAAAAGAAACAACAACAACAAAACGTC ATAGCTTCATATCTGTCCAAAACAAACTACCAACGAGGGATATTTGTGGA CATTGCCACAAAAAAATTAATTAAATTTCAAATATTTCATTTTCTAGTAA GAGTACAAAATTATTTCATTTTATTGGGGGGAGGCTACAGCCCCTGCGGA CCCCAATGGTTAAGCCCCTTAAGATGATGAAGCGGGAATATAATACTTAT TAAAGAATATGTATTCCTTGTCTCTCGACTTCCTTTCTTGTATGTTATAT ACATCTATATTTAGGTCACTAGGTCTTGACGAATAGAGAGAGACAAGGCA GATTGGCGGRTTTGGTGCCTTCCCTTGGCGTGGGCCTCTTTCTCTCTTCC CACTCCACCTTTTTCTTCTCCGTACATTCTTATACATAACATATTTTGAA GGAATGTTTAAGATACTCTCAAACAGCTAGTTCCCTCAATCCCTTCTTAT CATATTTAATTGAGAGGGATGATTCATTAATTATGTTTGTATTCAACTAT TCAAATTATGTTTGTATATTAAAGGGGGTTATTATTATTTATATATCTAC ACTTTAAATGTTTAGTACATTTGCTATTGAGGAGGTAAGCCGCTCGCTTT TCAAATTAAGATATGTATATTATGTGTATAGAATATACATCTCATCGCTC CCAAATTGATCTTGACCTAGTTTTTTTGTTTTTGTTTTTTTCATACTTCA TTTTGTATGAATGTCCTCGTCTATTTTCAAGTTACTTTCGCAATACTTAC TTTCAGGGGCGTCCGCAGGATAATATTTTTTTGGGGAGCTTGGTTTTCGG AAATTAAATTTTCTGAAGAAAATGACATATAATTTTTTAGTGTAGGCTGT GTAGGTGTAGTGTGGATACAACCTCAAAAATGTATATTGAATTAAATATA ATATGTACTATATATTTATTTGTAGGTGGATGATCAAATGAAACTCCTTC AGAATTCATGGTCGGAAATGTTGATATTAGATCAAATTCATCAGAGAATG CACAATCACCTACCGGACGAAACACCATTACCCAATGGGCAAAAATTCGA ACTTCTTTCATTGGCCCTCTTGGGTGTACCATCCATGTCCGACTCCTTCC AAGAAATTACCAATAAATTACAATCTTTAAAATTTGATAGTGCAGACTAT GTCTGCTTAAAATTCGTACTTTTGTTAAACCCTGGTAAGATTTATATATA CTTTATAAGTGTTTTTCTTATATTATCATTCTTATTTTTCCTCCCTCTAG AAGTACGAAATTTGAACAATCGTACTCATGTTCAAGAATGTCATGAACAA GTCCATCGAATACTATTAGAATACTGT
back to top
Add to Basket