EMLSAG00000009319, EMLSAG00000009319-692085 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000009319
Unique NameEMLSAG00000009319-692085
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
O F135 (BDH2) BDH2 female
  1. PreAdult2
  2. Adult
-Missing-
no visible phenotype
02.12.2013 (All day)
08.01.2014 (All day)
NAH F135 BDH2 unknown
  1. Nauplius I
  2. Adult
-Missing-
no visible phenotype
21.11.2014 (All day)
12.01.2015 (All day)
Homology
BLAST of EMLSAG00000009319 vs. GO
Match: - (symbol:LOC100522692 "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0016491 "oxidoreductase activity" evidence=IEA] InterPro:IPR002198 InterPro:IPR020904 PRINTS:PR00080 PROSITE:PS00061 InterPro:IPR016040 InterPro:IPR002347 Gene3D:3.40.50.720 GO:GO:0016491 PRINTS:PR00081 GO:GO:0055114 GeneTree:ENSGT00710000106273 KO:K00019 OrthoDB:EOG7W154W TreeFam:TF328795 OMA:HERIQAR EMBL:CU862009 RefSeq:XP_003129333.2 RefSeq:XP_003357106.1 Ensembl:ENSSSCT00000024244 GeneID:100522692 KEGG:ssc:100522692 Uniprot:I3LHC8)

HSP 1 Score: 283.493 bits (724), Expect = 4.386e-94
Identity = 139/247 (56.28%), Postives = 173/247 (70.04%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV ++TAAAQGIGR  AL FA+EGAKV ATDINE+ L+EL N+ GI    LDVT K+ +    + I E +D+LFN AG+VHHG+ILDC+E  W  S  +NV SMY M KA +P M+  +K G+IINMSS+ SSIKG+ NR  Y  TKAAVIG TKS+A D ++  IR NC+CPGTVDTPSL+ R+   PNPE+  +DF+ RQ   R  T+ E+A   + LA D  AY TG    IDGG S+
Sbjct:    1 MGRLDGKVIILTAAAQGIGRAAALAFAREGAKVIATDINESKLQELENYPGIQTRVLDVTKKKQIDEFANDI-ERLDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLA-QKSGNIINMSSVASSIKGVVNRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARPNPEEALSDFLKRQKTGRFATAEEVALLCVYLASDESAYVTGNPVVIDGGWSL 245          
BLAST of EMLSAG00000009319 vs. GO
Match: - (symbol:BDH2 "3-hydroxybutyrate dehydrogenase type 2" species:9913 "Bos taurus" [GO:0003858 "3-hydroxybutyrate dehydrogenase activity" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0006635 "fatty acid beta-oxidation" evidence=IEA] [GO:0016628 "oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor" evidence=IEA] [GO:0019290 "siderophore biosynthetic process" evidence=IEA] [GO:0051287 "NAD binding" evidence=IEA] [GO:0055072 "iron ion homeostasis" evidence=IEA] InterPro:IPR002198 InterPro:IPR020904 PRINTS:PR00080 PROSITE:PS00061 InterPro:IPR016040 InterPro:IPR002347 GO:GO:0005737 Gene3D:3.40.50.720 GO:GO:0051287 PRINTS:PR00081 GO:GO:0006635 GO:GO:0016628 GeneTree:ENSGT00710000106273 GO:GO:0055072 UniGene:Bt.1792 GeneID:515321 KEGG:bta:515321 CTD:56898 KO:K00019 GO:GO:0003858 GO:GO:0019290 OrthoDB:EOG7W154W TreeFam:TF328795 EMBL:DAAA02016739 EMBL:DAAA02016732 EMBL:DAAA02016733 EMBL:DAAA02016734 EMBL:DAAA02016735 EMBL:DAAA02016736 EMBL:DAAA02016737 EMBL:DAAA02016738 RefSeq:XP_005207665.1 Ensembl:ENSBTAT00000003277 OMA:HERIQAR Uniprot:F1MLA4)

HSP 1 Score: 280.411 bits (716), Expect = 6.422e-93
Identity = 139/247 (56.28%), Postives = 173/247 (70.04%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV ++TAAAQGIGR  AL FAKEGAKV ATDIN++ L+EL  + GI    LDVT K+ +    + I E +D+LFN AG+VHHG+ILDC+E  W  S  +NV SMY M KA +P M+  +K G+IINMSS+ SSIKG+ NR  Y TTKAAVIG TKS+A D ++  IR NC+CPGTVDTPSL+ R+   PNPE+  +DF+ RQ   R  T+ E+A   + LA D  AY TG    IDGG S+
Sbjct:    1 MGRLDGKVIVLTAAAQGIGRAAALAFAKEGAKVIATDINDSKLQELDKYPGIHTRVLDVTKKKQIDQFANDI-ERLDVLFNVAGFVHHGTILDCEETDWDFSMNLNVRSMYLMIKAFLPKMLA-QKSGNIINMSSVASSIKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARPNPEEALSDFLKRQKTGRFATAEEVALLCVYLASDESAYITGNPVIIDGGWSL 245          
BLAST of EMLSAG00000009319 vs. GO
Match: - (symbol:BDH2 "3-hydroxybutyrate dehydrogenase type 2" species:9913 "Bos taurus" [GO:0003858 "3-hydroxybutyrate dehydrogenase activity" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0016628 "oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor" evidence=ISS] [GO:0019290 "siderophore biosynthetic process" evidence=ISS] [GO:0042168 "heme metabolic process" evidence=ISS] [GO:0055072 "iron ion homeostasis" evidence=ISS] InterPro:IPR002198 InterPro:IPR020904 PRINTS:PR00080 PROSITE:PS00061 InterPro:IPR016040 InterPro:IPR002347 GO:GO:0005737 Gene3D:3.40.50.720 eggNOG:COG1028 PRINTS:PR00081 GO:GO:0016628 GO:GO:0055072 EMBL:BC102567 RefSeq:NP_001029660.1 UniGene:Bt.1792 ProteinModelPortal:Q3T046 SMR:Q3T046 STRING:9913.ENSBTAP00000051312 PRIDE:Q3T046 GeneID:515321 KEGG:bta:515321 CTD:56898 HOVERGEN:HBG002145 KO:K00019 NextBio:20871766 GO:GO:0003858 GO:GO:0042168 GO:GO:0019290 Uniprot:Q3T046)

HSP 1 Score: 280.411 bits (716), Expect = 7.894e-93
Identity = 139/247 (56.28%), Postives = 173/247 (70.04%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV ++TAAAQGIGR  AL FAKEGAKV ATDIN++ L+EL  + GI    LDVT K+ +    + I E +D+LFN AG+VHHG+ILDC+E  W  S  +NV SMY M KA +P M+  +K G+IINMSS+ SSIKG+ NR  Y TTKAAVIG TKS+A D ++  IR NC+CPGTVDTPSL+ R+   PNPE+  +DF+ RQ   R  T+ E+A   + LA D  AY TG    IDGG S+
Sbjct:    1 MGRLDGKVIVLTAAAQGIGRAAALAFAKEGAKVIATDINDSKLQELDKYPGIHTRVLDVTKKKQIDQFANDI-ERLDVLFNVAGFVHHGTILDCEETDWDFSMNLNVRSMYLMIKAFLPKMMA-QKSGNIINMSSVASSIKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARPNPEEALSDFLKRQKTGRFATAEEVALLCVYLASDESAYITGNPVIIDGGWSL 245          
BLAST of EMLSAG00000009319 vs. GO
Match: - (symbol:BDH2 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0003858 "3-hydroxybutyrate dehydrogenase activity" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0006635 "fatty acid beta-oxidation" evidence=IEA] [GO:0016628 "oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor" evidence=IEA] [GO:0019290 "siderophore biosynthetic process" evidence=IEA] [GO:0051287 "NAD binding" evidence=IEA] [GO:0055072 "iron ion homeostasis" evidence=IEA] InterPro:IPR002198 InterPro:IPR020904 PRINTS:PR00080 PROSITE:PS00061 InterPro:IPR016040 InterPro:IPR002347 GO:GO:0005737 Gene3D:3.40.50.720 GO:GO:0051287 PRINTS:PR00081 GO:GO:0006635 GO:GO:0016628 GeneTree:ENSGT00710000106273 GO:GO:0055072 CTD:56898 KO:K00019 GO:GO:0003858 GO:GO:0019290 OrthoDB:EOG7W154W TreeFam:TF328795 EMBL:AADN03004249 RefSeq:XP_420669.1 UniGene:Gga.2925 Ensembl:ENSGALT00000020161 GeneID:422715 KEGG:gga:422715 OMA:DWEEAFL Uniprot:F1NAM7)

HSP 1 Score: 278.87 bits (712), Expect = 2.784e-92
Identity = 135/247 (54.66%), Postives = 175/247 (70.85%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV L++AAAQGIGR TA+ FAKEGAKV ATDIN+  L+EL  + GI +  LDVT +E +      I E ID+L N AG+VHHG+ILDC+E+ W  +  +NV SMY M K  +P MI+ +K G+IINMSS+ SSIKG+ NR  Y T+KAAVIG TKS+A D ++  IR NC+CPGTVDTPSL+ R+   PNP++   DF+ RQ + R+ T+ E+A   + LA +  AY TG +  IDGG S+
Sbjct:    1 MGRLDGKVILLSAAAQGIGRATAIAFAKEGAKVIATDINKTKLQELEIYPGIQVRVLDVTKREQIEELAKEI-ERIDVLCNIAGFVHHGTILDCEEEDWNFAMNLNVRSMYLMIKTFLPKMIK-QKSGNIINMSSVASSIKGVVNRCVYSTSKAAVIGLTKSVAADFIEQGIRCNCVCPGTVDTPSLQQRIKAQPNPDQALKDFLARQRIGRMATAEEVAHLFVYLASEESAYMTGNEVVIDGGWSL 245          
BLAST of EMLSAG00000009319 vs. GO
Match: - (symbol:bdh2 "3-hydroxybutyrate dehydrogenase type 2" species:8355 "Xenopus laevis" [GO:0016628 "oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor" evidence=ISS] [GO:0019290 "siderophore biosynthetic process" evidence=ISS] [GO:0042168 "heme metabolic process" evidence=ISS] [GO:0055072 "iron ion homeostasis" evidence=ISS] InterPro:IPR002198 InterPro:IPR020904 PRINTS:PR00080 PROSITE:PS00061 InterPro:IPR016040 InterPro:IPR002347 GO:GO:0005737 Gene3D:3.40.50.720 PRINTS:PR00081 GO:GO:0016628 GO:GO:0055072 CTD:56898 HOVERGEN:HBG002145 KO:K00019 GO:GO:0003858 GO:GO:0042168 GO:GO:0019290 EMBL:BC106561 RefSeq:NP_001089786.1 UniGene:Xl.50156 ProteinModelPortal:Q3KPT7 SMR:Q3KPT7 GeneID:734851 KEGG:xla:734851 Xenbase:XB-GENE-985759 Uniprot:Q3KPT7)

HSP 1 Score: 278.87 bits (712), Expect = 3.171e-92
Identity = 136/247 (55.06%), Postives = 173/247 (70.04%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV +++AAAQGIGR  A+ FAKEGA+V ATD+NE  LKEL  ++GI    LDVT K+ + N    I + ID+LFN AG+VHHG+ILDC E  W  +  +NV SMY+M K  +P M+  +K G+IINMSS+ SSIKG+ NR  Y T+KAAVIG TKS+A D +   IR NCICPGTVDTPSLR R+   P+PE+   DF+ RQ   R+ T+ E+A   + LA D  AY TG ++ IDGG S+
Sbjct:    1 MGRLDGKVIVLSAAAQGIGRAAAIAFAKEGAQVIATDVNEMKLKELEAYKGIQTRVLDVTKKDQIENLCKEI-DRIDVLFNVAGFVHHGTILDCTEADWDFTMNVNVRSMYFMIKTFLPKMLA-QKSGNIINMSSVASSIKGVVNRCVYSTSKAAVIGLTKSVASDFIDQGIRCNCICPGTVDTPSLRERIQARPDPEQALKDFLARQRTGRMATAEEVAHLCVYLASDESAYVTGNEHIIDGGWSL 245          
BLAST of EMLSAG00000009319 vs. GO
Match: - (symbol:Bdh2 "3-hydroxybutyrate dehydrogenase, type 2" species:10116 "Rattus norvegicus" [GO:0003858 "3-hydroxybutyrate dehydrogenase activity" evidence=IEA;ISO] [GO:0005737 "cytoplasm" evidence=IEA;ISO] [GO:0006635 "fatty acid beta-oxidation" evidence=IEA;ISO] [GO:0016628 "oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor" evidence=ISO;ISS] [GO:0019290 "siderophore biosynthetic process" evidence=ISO;ISS] [GO:0030855 "epithelial cell differentiation" evidence=ISO] [GO:0042168 "heme metabolic process" evidence=ISS] [GO:0051287 "NAD binding" evidence=IEA;ISO] [GO:0055072 "iron ion homeostasis" evidence=ISO;ISS] [GO:0055114 "oxidation-reduction process" evidence=ISO] [GO:0070062 "extracellular vesicular exosome" evidence=ISO] [GO:0005739 "mitochondrion" evidence=ISO] InterPro:IPR002198 InterPro:IPR020904 PRINTS:PR00080 PROSITE:PS00061 InterPro:IPR016040 InterPro:IPR002347 RGD:1309898 GO:GO:0005737 Gene3D:3.40.50.720 GO:GO:0051287 PRINTS:PR00081 GO:GO:0006635 GO:GO:0016628 GO:GO:0055072 CTD:56898 KO:K00019 GO:GO:0003858 GO:GO:0042168 GO:GO:0019290 OrthoDB:EOG7W154W TreeFam:TF328795 EMBL:CH473952 RefSeq:NP_001099943.1 RefSeq:XP_006233384.1 UniGene:Rn.3651 ProteinModelPortal:D4A1J4 PRIDE:D4A1J4 GeneID:295458 KEGG:rno:295458 NextBio:639610 PRO:PR:D4A1J4 Uniprot:D4A1J4)

HSP 1 Score: 274.633 bits (701), Expect = 1.360e-90
Identity = 136/247 (55.06%), Postives = 170/247 (68.83%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRL+GKV ++TAAAQGIGR +AL FA+EGAKV ATDINEA L+EL N+ GI    LDVT K  +      I E ID+LFN AG+VHHG+ILDC+E  W  S  +NV SMY M KA +P M+  +K G+IINMSS+ SSIKG+ NR  Y  TKAAVIG TKS+A D ++  IR NC+CPGTVDTPSL+ R+    +P++    F+NRQ   R  ++ E+A   + LA D  AY TG    IDGG S+
Sbjct:    1 MGRLEGKVIVLTAAAQGIGRASALAFAREGAKVIATDINEAKLQELENYPGIQTRVLDVTKKRQIDQFASEI-EKIDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLA-QKSGNIINMSSVASSIKGVENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARDDPKEALKAFLNRQKTGRFASAEEVALLCVYLASDESAYVTGTPVVIDGGWSL 245          
BLAST of EMLSAG00000009319 vs. GO
Match: - (symbol:Bdh2 "3-hydroxybutyrate dehydrogenase, type 2" species:10090 "Mus musculus" [GO:0003858 "3-hydroxybutyrate dehydrogenase activity" evidence=ISO] [GO:0005737 "cytoplasm" evidence=ISO] [GO:0006635 "fatty acid beta-oxidation" evidence=ISO] [GO:0008152 "metabolic process" evidence=IEA] [GO:0016491 "oxidoreductase activity" evidence=IEA] [GO:0016628 "oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor" evidence=IMP] [GO:0019290 "siderophore biosynthetic process" evidence=IMP] [GO:0030855 "epithelial cell differentiation" evidence=ISO] [GO:0051287 "NAD binding" evidence=ISO] [GO:0055072 "iron ion homeostasis" evidence=IMP] [GO:0055114 "oxidation-reduction process" evidence=IMP] [GO:0070062 "extracellular vesicular exosome" evidence=ISO] InterPro:IPR002198 InterPro:IPR020904 PRINTS:PR00080 PROSITE:PS00061 InterPro:IPR016040 InterPro:IPR002347 MGI:MGI:1917022 GO:GO:0005737 Gene3D:3.40.50.720 GO:GO:0051287 eggNOG:COG1028 PRINTS:PR00081 GO:GO:0006635 GO:GO:0016628 GeneTree:ENSGT00710000106273 GO:GO:0055072 CTD:56898 HOVERGEN:HBG002145 KO:K00019 GO:GO:0003858 GO:GO:0042168 GO:GO:0019290 OrthoDB:EOG7W154W TreeFam:TF328795 EMBL:BC036998 RefSeq:NP_081484.1 UniGene:Mm.45121 ProteinModelPortal:Q8JZV9 SMR:Q8JZV9 STRING:10090.ENSMUSP00000112683 PhosphoSite:Q8JZV9 PaxDb:Q8JZV9 PRIDE:Q8JZV9 Ensembl:ENSMUST00000029817 Ensembl:ENSMUST00000120397 GeneID:69772 KEGG:mmu:69772 UCSC:uc008rla.2 InParanoid:Q8JZV9 NextBio:330302 PRO:PR:Q8JZV9 ArrayExpress:Q8JZV9 Bgee:Q8JZV9 CleanEx:MM_BDH2 Genevestigator:Q8JZV9 Uniprot:Q8JZV9)

HSP 1 Score: 274.248 bits (700), Expect = 2.169e-90
Identity = 135/247 (54.66%), Postives = 170/247 (68.83%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV ++TAAAQGIGR +AL FA+EGAKV ATDINE+ L+EL ++ GI    LDVT K  +      I E ID+LFN AG+VHHG+ILDC+E  W  S  +NV SM+ M KA +P M+  +K G+IINMSS+ SSIKG+ NR  Y  TKAAVIG TKS+A D ++  IR NC+CPGTVDTPSL+ R+    NP++    F+NRQ   R  ++ E+A   + LA D  AY TG    IDGG S+
Sbjct:    1 MGRLDGKVIVLTAAAQGIGRASALAFAREGAKVIATDINESKLQELESYRGIQTRVLDVTKKRQIDQFASEI-ERIDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMFLMIKAFLPKMLA-QKSGNIINMSSVASSIKGVENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARDNPKEALKTFLNRQKTGRFASAEEVALLCVYLASDESAYVTGNPVIIDGGWSL 245          
BLAST of EMLSAG00000009319 vs. GO
Match: - (symbol:bdh2 "3-hydroxybutyrate dehydrogenase type 2" species:8400 "Rana catesbeiana" [GO:0016628 "oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor" evidence=ISS] [GO:0019290 "siderophore biosynthetic process" evidence=ISS] [GO:0042168 "heme metabolic process" evidence=ISS] [GO:0055072 "iron ion homeostasis" evidence=ISS] InterPro:IPR002198 InterPro:IPR020904 PRINTS:PR00080 PROSITE:PS00061 InterPro:IPR016040 InterPro:IPR002347 GO:GO:0005737 Gene3D:3.40.50.720 PRINTS:PR00081 GO:GO:0016628 GO:GO:0055072 GO:GO:0003858 GO:GO:0042168 GO:GO:0019290 EMBL:BT081559 EMBL:BT081847 ProteinModelPortal:C1C4R8 Uniprot:C1C4R8)

HSP 1 Score: 272.707 bits (696), Expect = 7.726e-90
Identity = 135/247 (54.66%), Postives = 171/247 (69.23%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV +++A AQGIG+  A+ FAKEGAKV ATDIN   LKEL +++GI    LDVT K+ +      I + ID+LFN AG+VHHGSILDC+E  W  +  +NV SMY M K  +P M+  +K G+IINMSS+ SSIKG+ NR  Y T+KAAVIG TKS+A D ++  IR NCICPGTVDTPSLR R+   P+PE+   DF+ RQ   R+ T+ E+A   + LA D  AY TG  + IDGG S+
Sbjct:    1 MGRLDGKVIVLSAGAQGIGKAAAIAFAKEGAKVIATDINGEKLKELESYKGIETRVLDVTKKDQIEKLSKEI-DRIDVLFNVAGFVHHGSILDCEEADWDFTMNVNVRSMYLMIKTFLPKMLA-QKSGNIINMSSVASSIKGVVNRCVYSTSKAAVIGLTKSVAADFIEQGIRCNCICPGTVDTPSLRERIEARPDPEQALKDFLARQKTGRMCTAEEVAHLCVYLASDEAAYVTGNAHIIDGGWSL 245          
BLAST of EMLSAG00000009319 vs. GO
Match: - (symbol:bdh2 "3-hydroxybutyrate dehydrogenase, type 2" species:7955 "Danio rerio" [GO:0016491 "oxidoreductase activity" evidence=IEA] [GO:0008152 "metabolic process" evidence=IEA] [GO:0003858 "3-hydroxybutyrate dehydrogenase activity" evidence=IEA] [GO:0042541 "hemoglobin biosynthetic process" evidence=IMP] [GO:0042168 "heme metabolic process" evidence=IMP] [GO:0016628 "oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor" evidence=ISS] [GO:0019290 "siderophore biosynthetic process" evidence=ISS] [GO:0055072 "iron ion homeostasis" evidence=ISS] [GO:0055114 "oxidation-reduction process" evidence=IEA;ISS] [GO:0005737 "cytoplasm" evidence=IEA] InterPro:IPR002198 InterPro:IPR020904 PRINTS:PR00080 PROSITE:PS00061 InterPro:IPR016040 InterPro:IPR002347 ZFIN:ZDB-GENE-050417-343 GO:GO:0005737 Gene3D:3.40.50.720 eggNOG:COG1028 PRINTS:PR00081 GO:GO:0016628 GeneTree:ENSGT00710000106273 GO:GO:0055072 CTD:56898 HOVERGEN:HBG002145 KO:K00019 GO:GO:0003858 GO:GO:0042168 GO:GO:0019290 EMBL:CR388005 EMBL:BC092874 RefSeq:NP_001017809.1 RefSeq:XP_005160124.1 RefSeq:XP_005160125.1 RefSeq:XP_005160126.1 UniGene:Dr.84969 ProteinModelPortal:Q561X9 SMR:Q561X9 STRING:7955.ENSDARP00000069085 Ensembl:ENSDART00000074597 Ensembl:ENSDART00000132542 GeneID:550507 KEGG:dre:550507 InParanoid:Q561X9 OMA:SKAVIPH OrthoDB:EOG7W154W TreeFam:TF328795 NextBio:20879749 PRO:PR:Q561X9 Bgee:Q561X9 GO:GO:0042541 Uniprot:Q561X9)

HSP 1 Score: 264.233 bits (674), Expect = 1.444e-86
Identity = 134/248 (54.03%), Postives = 172/248 (69.35%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDV-MNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV +++AAAQGIG+ +A+ FAKEGA+V ATDIN   LKEL    GI    +DVT K+ V   AKD   + +D+LFN AG+VHHGSILDC+E  W  +  +NV SMY M KA +P M+  +K G+IINM+S+ SSIKG+ NR  Y T+KAAVIG TKS+A D ++  IR NCICPGTVDTPSLR R+   P+PE+ + DF+ RQ   RL T+ E+A   + LA D   + TG +  IDGG  +
Sbjct:    1 MGRLDGKVIVLSAAAQGIGKASAIAFAKEGAQVTATDINGEKLKELDGIPGIKTKVVDVTKKDQVDALAKD--FDHVDVLFNIAGFVHHGSILDCEESDWDFTMNVNVRSMYLMIKAFLPKMLA-RKSGNIINMASVASSIKGVVNRCVYSTSKAAVIGLTKSVAADFLEQGIRCNCICPGTVDTPSLRERIQARPDPEQAFKDFMARQRTGRLCTAEEVAHLCVYLASDESTFVTGTEVIIDGGWRL 245          
BLAST of EMLSAG00000009319 vs. GO
Match: - (symbol:BDH2 "3-hydroxybutyrate dehydrogenase type 2" species:9606 "Homo sapiens" [GO:0003858 "3-hydroxybutyrate dehydrogenase activity" evidence=IDA] [GO:0005737 "cytoplasm" evidence=IDA] [GO:0006635 "fatty acid beta-oxidation" evidence=IDA] [GO:0016628 "oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor" evidence=ISS] [GO:0019290 "siderophore biosynthetic process" evidence=ISS] [GO:0030855 "epithelial cell differentiation" evidence=IDA] [GO:0042168 "heme metabolic process" evidence=ISS] [GO:0051287 "NAD binding" evidence=IDA] [GO:0055072 "iron ion homeostasis" evidence=ISS] [GO:0070062 "extracellular vesicular exosome" evidence=IDA] [GO:0005739 "mitochondrion" evidence=IDA] InterPro:IPR002198 InterPro:IPR020904 PRINTS:PR00080 PROSITE:PS00061 InterPro:IPR016040 InterPro:IPR002347 GO:GO:0005737 GO:GO:0070062 Gene3D:3.40.50.720 GO:GO:0051287 eggNOG:COG1028 PRINTS:PR00081 GO:GO:0006635 GO:GO:0030855 GO:GO:0016628 GO:GO:0055072 CTD:56898 HOVERGEN:HBG002145 KO:K00019 GO:GO:0003858 GO:GO:0042168 GO:GO:0019290 OMA:SKAVIPH OrthoDB:EOG7W154W TreeFam:TF328795 EMBL:AF164790 EMBL:AY358841 EMBL:CR457309 EMBL:AK023323 EMBL:AK290160 EMBL:AK300626 EMBL:AC097485 EMBL:BC037277 EMBL:BC001953 EMBL:BC095414 RefSeq:NP_064524.3 RefSeq:XP_005263196.1 UniGene:Hs.124696 PDB:2AG5 PDBsum:2AG5 ProteinModelPortal:Q9BUT1 SMR:Q9BUT1 BioGrid:121228 STRING:9606.ENSP00000296424 PhosphoSite:Q9BUT1 DMDM:125987797 PaxDb:Q9BUT1 PRIDE:Q9BUT1 Ensembl:ENST00000296424 GeneID:56898 KEGG:hsa:56898 UCSC:uc003hwz.3 GeneCards:GC04M103998 H-InvDB:HIX0032960 HGNC:HGNC:32389 HPA:HPA036028 HPA:HPA036029 neXtProt:NX_Q9BUT1 PharmGKB:PA142672559 InParanoid:Q9BUT1 PhylomeDB:Q9BUT1 BioCyc:MetaCyc:HS08987-MONOMER SABIO-RK:Q9BUT1 EvolutionaryTrace:Q9BUT1 GenomeRNAi:56898 NextBio:62339 PRO:PR:Q9BUT1 ArrayExpress:Q9BUT1 Bgee:Q9BUT1 CleanEx:HS_BDH2 Genevestigator:Q9BUT1 Uniprot:Q9BUT1)

HSP 1 Score: 256.529 bits (654), Expect = 1.528e-83
Identity = 135/247 (54.66%), Postives = 171/247 (69.23%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV ++TAAAQGIG+  AL FA+EGAKV ATDINE+ L+EL  + GI    LDVT K+ +    + + E +D+LFN AG+VHHG++LDC+E  W  S  +NV SMY M KA +P M+  +K G+IINMSS+ SS+KG+ NR  Y TTKAAVIG TKS+A D ++  IR NC+CPGTVDTPSL+ R+    NPE+   DF+ RQ   R  T+ EIA   + LA D  AY TG    IDGG S+
Sbjct:    1 MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQTRVLDVTKKKQIDQFANEV-ERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLA-QKSGNIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL 245          
BLAST of EMLSAG00000009319 vs. C. finmarchicus
Match: gi|592770974|gb|GAXK01183594.1| (TSA: Calanus finmarchicus comp57085_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 262.307 bits (669), Expect = 9.283e-86
Identity = 142/252 (56.35%), Postives = 184/252 (73.02%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKEL-----SNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGXXXXXXXXXXXXKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGR++ K+ +ITAA QGIGR +AL+ A+EGA V ATDI E LL+EL     + +  I++ ++DVT K D++   + + E +D+LFNCAGYVH GSI DC ++ ++RS  INV SM++MC+ + P + +   GGSIINMSS+CSSIKG PNRFAYGTTKAAVIG TKSL+ DLV  +IRVN ICPGTV+TPS +GRVN + +P+    +FI RQ M RLGT+ EIA+ V  LA D  AY TG +  IDGG SI
Sbjct:   90 MGRVEDKLVVITAAGQGIGRASALMLAREGATVIATDIREDLLEELAEVAKTENLKITVKRVDVTTKSDILALAEGL-EKVDVLFNCAGYVHQGSIFDCSDEVFERSMNINVRSMFWMCQTLAPKVPD---GGSIINMSSVCSSIKGAPNRFAYGTTKAAVIGLTKSLSADLVSRHIRVNAICPGTVETPSWQGRVNESEDPDLARKEFIARQKMGRLGTAEEIAALVTYLASDESAYTTGTEQVIDGGWSI 833          
BLAST of EMLSAG00000009319 vs. C. finmarchicus
Match: gi|592909287|gb|GAXK01049088.1| (TSA: Calanus finmarchicus comp64383_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 108.227 bits (269), Expect = 2.767e-26
Identity = 80/253 (31.62%), Postives = 116/253 (45.85%), Query Frame = 0
Query:    2 GRLDGKVALITAAAQGIGRETALLFAKEGAKVY-----ATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITE---SIDILF-NCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGXXXXXXXXXXXXKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGL 245
            G+L GKVA++TA+  GIG   A   A+ GA V      A ++  A+ K  ++   +S     V  + D  N      +    +DIL  N A   + G  LDC ED+W + FEINV   + + K  VP M++  +GG      S     + +     Y  +K A+ G TK LA +    NIRVNCI PG + T       +N    E      +   P+ R G  +E+   V  LA D  +Y TG    + GG+
Sbjct:  283 GKLSGKVAIVTASTDGIGFGIAENLARHGAHVMLSSRKADNVTAAVEKLQADGLSVSGTVCHVGKQGDRSNLFQQTVDKFGGLDILVSNAAVNPYFGPTLDCPEDAWDKIFEINVKVAFLLFKESVPLMLQ--RGGGSAVFVSSIGGFQPISALGPYSVSKTALFGLTKVLASEAAADNIRVNCIAPGIIQTKFAAALTDN----EDIADRVLETVPLGRFGQPSEMGGIVSFLASDEASYVTGETIVLAGGM 1023          
BLAST of EMLSAG00000009319 vs. C. finmarchicus
Match: gi|592911710|gb|GAXK01046665.1| (TSA: Calanus finmarchicus comp138768_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 99.3673 bits (246), Expect = 2.280e-23
Identity = 77/260 (29.62%), Postives = 123/260 (47.31%), Query Frame = 0
Query:    2 GRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEAL-------LKELSNHEGISIFKLDVTNKEDVMNAKDSITES---IDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIE-NKKGGXXXXXXXXXXXXKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLR------GRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            GR DG+VA++T  A GIG      F  +GA V   D+NE         LK +        +K+DV+++    +A  ++  +   ++ L NC  Y    S L+  E  W+++  +NV    +M +A+V  M   + K    +   S  S+ +  PNR+ Y  +K A+   TK++A DL K  IRVN + PG + +P +       GR    P   K +          RLG  +E+A+ V  LA  + ++    D K+DGG
Sbjct:  162 GRFDGQVAIVTGGAGGIGGMIVQRFLSDGAAVAILDMNEERGKEKIEELKAVGLDTKAKFYKVDVSSRTACFSAVSAVAANFGKVNHLVNCVAYFGSQS-LEATESDWQKTMSVNVMGSSFMVQAVVEQMKNYSAKENCSVVNLSSISAHQTQPNRWTYAASKGAINILTKNMALDLAKFKIRVNSVSPGWIWSPEVAKAAAEGGRAKWEPVWGKFHIS-------NRLGDMSEVAAAVTFLASLDASFVNATDLKVDGG 917          
BLAST of EMLSAG00000009319 vs. C. finmarchicus
Match: gi|592821194|gb|GAXK01133374.1| (TSA: Calanus finmarchicus comp1332819_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 98.2117 bits (243), Expect = 5.549e-23
Identity = 71/247 (28.74%), Postives = 115/247 (46.56%), Query Frame = 0
Query:    4 LDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLD--VTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGXXX--XXXXXXXXXKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRG--RVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
             +G+  LIT  A GIG  +A LF K GA+V+  DI     +  +N  G+   + D  +    +   A  +     D+L N               + W+R+  +N+ S +   +A +  M+E+K+GG I+         S  G+P   +Y  +K  V+ FT+ LA +  ++NIRVN I PGT  TP ++   ++  T   E   +       M R+G   EIA  +  +A    ++ TG +  IDGG
Sbjct:  187 FNGQRVLITGGADGIGAVSAALFLKRGAEVFIADIKPP--EPSANMPGLHYIQCDAGIPADVEAAAAIVAAAGGCDVLVNNVAIQPEAPCHQMSLEQWERTIAVNLTSYFLFSQACIRQMLEHKRGGVIVNIASVQGSQSQPGIP---SYAASKGGVLAFTRQLAVEYGRNNIRVNAISPGTTATPLIQNILKLRGTTEEEAGKSTC-----MHRIGRPEEIARAICFVASKEASFMTGENLTIDGG 897          
BLAST of EMLSAG00000009319 vs. C. finmarchicus
Match: gi|592924811|gb|GAXK01033604.1| (TSA: Calanus finmarchicus comp83857_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 97.4413 bits (241), Expect = 8.955e-23
Identity = 82/258 (31.78%), Postives = 126/258 (48.84%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNH------EGISIFKLDVTNKEDVMN-AKDSITE--SIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGXXXXXXXXXXXXKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTP-SLRGRVNNTPNPEKTYTDFINR----QPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            M  L GKVA+IT A+ GIG  TA+ FAK GA +  T  N   L+E +        +   + + D+  +ED     +D+I +    D+L N AG +  GSI +   + + R   INV ++Y +    VP + E  +G   I   S  + I+  P   AY  +KAAV  FT+ +A +L    IRVN + PG + T    RG ++      + Y +F+        + R G   E+A  +  LA D+ ++ TG    +DGG
Sbjct:   80 MNSLVGKVAIITGASSGIGAATAIHFAKLGATLSITGRNVENLQETAKKCVDNGAKDPFLIQADLVKEEDCTKIIQDTIAKYGKFDVLVNNAGVLELGSIENTSLEQYDRVMNINVRAIYNLTMLAVPHL-EKTQGN--IVNVSSVNGIRSFPGVLAYNISKAAVDQFTRCVALELAPKKIRVNGVNPGVIATELQKRGGLDG-----ERYENFLEHSKTTHALGRTGEVFEVAKAIGFLASDDASFSTGVSLPVDGG 829          
BLAST of EMLSAG00000009319 vs. C. finmarchicus
Match: gi|592762762|gb|GAXK01191651.1| (TSA: Calanus finmarchicus comp40688_c3_seq3 transcribed RNA sequence)

HSP 1 Score: 97.0561 bits (240), Expect = 1.355e-22
Identity = 75/251 (29.88%), Postives = 124/251 (49.40%), Query Frame = 0
Query:    4 LDGKVALITAAAQGIGRETALLFAKEGAKVYATDIN----EALLKELSNHEGISIFKLDVTNKEDV----MNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGXXXXXXXXXXXXKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLS 246
            L G++AL+T   +GIGR    + A++ AKV  TD++    +  L+ L   +  S+   DV+    V        D    + DI+ N AG    G +L   E+ + +  ++N+   + + +A    M E +  GSI+N++SI      +  +  Y  +KA VIGFTK+ A +L +  IRVN I PG + TP           P+K  T  +++ P+   G   +IA  V  LA +   Y TG  + ++GG++
Sbjct:  127 LSGRLALVTGGGRGIGRAVCQILARDNAKVVVTDLSMDSCQETLQSLRPDDHFSVAS-DVSQSASVNECFKQILDKYKRAPDIIVNSAGITKDGFMLRMKEEDFDKVIDVNLKGTFLVTQAAASLMKEQQLPGSIVNIASIVGKTGNI-GQANYTASKAGVIGFTKTAAKELGRFGIRVNVILPGFIKTPM------TDVVPDKVKTGILSQIPLGDFGDPIDIAEAVAFLACERSKYITGASFDVNGGMA 855          
BLAST of EMLSAG00000009319 vs. C. finmarchicus
Match: gi|592924812|gb|GAXK01033603.1| (TSA: Calanus finmarchicus comp83857_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 97.4413 bits (241), Expect = 2.557e-22
Identity = 82/258 (31.78%), Postives = 126/258 (48.84%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNH------EGISIFKLDVTNKEDVMN-AKDSITE--SIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGXXXXXXXXXXXXKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTP-SLRGRVNNTPNPEKTYTDFINR----QPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            M  L GKVA+IT A+ GIG  TA+ FAK GA +  T  N   L+E +        +   + + D+  +ED     +D+I +    D+L N AG +  GSI +   + + R   INV ++Y +    VP + E  +G   I   S  + I+  P   AY  +KAAV  FT+ +A +L    IRVN + PG + T    RG ++      + Y +F+        + R G   E+A  +  LA D+ ++ TG    +DGG
Sbjct:  477 MNSLVGKVAIITGASSGIGAATAIHFAKLGATLSITGRNVENLQETAKKCVDNGAKDPFLIQADLVKEEDCTKIIQDTIAKYGKFDVLVNNAGVLELGSIENTSLEQYDRVMNINVRAIYNLTMLAVPHL-EKTQGN--IVNVSSVNGIRSFPGVLAYNISKAAVDQFTRCVALELAPKKIRVNGVNPGVIATELQKRGGLDG-----ERYENFLEHSKTTHALGRTGEVFEVAKAIGFLASDDASFSTGVSLPVDGG 1226          
BLAST of EMLSAG00000009319 vs. C. finmarchicus
Match: gi|592817815|gb|GAXK01136753.1| (TSA: Calanus finmarchicus comp716955_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 89.7373 bits (221), Expect = 4.181e-20
Identity = 70/254 (27.56%), Postives = 115/254 (45.28%), Query Frame = 0
Query:    4 LDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNH------EGISIFKLDVTNKEDVMNAKDSITE---SIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGXXXXXXXXXXXXKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINR-QPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            L GKV +IT A+ GIG  TAL  A  G ++     N++ L+ +S        EG+ +   DV  +E+     +   +    ID+L N AG +               S ++N+ S   +C+A +P +   + G   I   S  + ++  P   AY  +KAA+   T+ +A ++    +RVN + PG + T         T     TY +   R  P+ R GT  E+A  +  LA  + ++ TG    +DGG S+
Sbjct:  118 LHGKVVIITGASSGIGAGTALHLASLGCRLSLVARNKSALESVSQECLVAGAEGVLVLSHDVGVEEECQALVEKTAQHFGGIDVLVNNAGVLIRSDFASVTMAEVDLSMQVNLKSAVKLCQACLPYL---ETGQGSIVNVSSIAGLRAYPGALAYKMSKAAMDQMTRCVALEVAPSGVRVNSVNPGVILTDIFTNS-GMTEEEANTYMETSKRLHPLGRPGTVLEVAKAITFLASADASFITGQTLAVDGGRSV 867          
BLAST of EMLSAG00000009319 vs. C. finmarchicus
Match: gi|592762764|gb|GAXK01191649.1| (TSA: Calanus finmarchicus comp40688_c3_seq1 transcribed RNA sequence)

HSP 1 Score: 86.6557 bits (213), Expect = 1.196e-18
Identity = 73/252 (28.97%), Postives = 119/252 (47.22%), Query Frame = 0
Query:    4 LDGKVALITAAAQGIGRETALLFAKEGAKVYATDIN----EALLKELSNHEGISIFKLDVTNKEDV----MNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGXXXXXXXXXXXXKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            L G++AL+T   +GIGR    + A++ AKV  TD++    +  L+ L   +  S+   DV+    V        D    + DI+ N AG    G +L   E+ + +  ++N+   + + +A    M E +  GSI+N++SI      +  +  Y  +KA VIGFTK+ A +L +  IRVN I PG + TP           P+K     + R  +   G   E+A     LA    ++ TG   ++ GGL +
Sbjct:  331 LSGRLALVTGGGRGIGRAVCQILARDNAKVVVTDLSMDSCQETLQSLRPDDHFSVAS-DVSQSASVNECFKQILDKYKRAPDIIVNSAGITKDGFMLRMKEEDFDKVIDVNLKGTFLVTQAAASLMKEQQLPGSIVNIASIVGKTGNI-GQANYTASKAGVIGFTKTAAKELGRFGIRVNVILPGFIKTPM------TDVVPDKVKQMSLTRIALGVHGEPEELAEVAAFLASRKASHMTGAVVEVTGGLDM 1062          
BLAST of EMLSAG00000009319 vs. C. finmarchicus
Match: gi|592762761|gb|GAXK01191652.1| (TSA: Calanus finmarchicus comp40688_c3_seq4 transcribed RNA sequence)

HSP 1 Score: 83.9593 bits (206), Expect = 6.092e-18
Identity = 73/274 (26.64%), Postives = 123/274 (44.89%), Query Frame = 0
Query:    4 LDGKVALITAAAQGIGRETALLFAKEGAKVYATDIN----EALLKELSNHEGISIFKLDVTNKEDV----MNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGXXXXXXXXXXXXKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSL------------------------RGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGL 245
            L G++AL+T   +GIGR    + A++ AKV  TD++    +  L+ L   +  S+   DV+    V        D    + DI+ N AG    G +L   E+ + +  ++N+   + + +A    M E +  GSI+N++SI      +  +  Y  +KA VIGFTK+ A +L +  IRVN I PG + TP                           G V+   + ++   + +  +P+   G   +IA     LA +   Y +G    ++GGL
Sbjct:   35 LSGRLALVTGGGRGIGRAVCQILARDNAKVVVTDLSMDSCQETLQSLRPDDHFSVAS-DVSQSASVNECFKQILDKYKRAPDIIVNSAGITKDGFMLRMKEEDFDKVIDVNLKGTFLVTQAAASLMKEQQLPGSIVNIASIVGKTGNI-GQANYTASKAGVIGFTKTAAKELGRFGIRVNVILPGFIKTPMTDVVPDKLKLMVQFQIPLSKSKKGKNGEVSEEDSWKRRLAERLVGRPLGDFGDPEDIAEAAAFLASNRSKYMSGASIDVNGGL 850          
BLAST of EMLSAG00000009319 vs. L. salmonis peptides
Match: EMLSAP00000009319 (pep:novel supercontig:LSalAtl2s:LSalAtl2s595:50362:51363:-1 gene:EMLSAG00000009319 transcript:EMLSAT00000009319 description:"maker-LSalAtl2s595-augustus-gene-0.32")

HSP 1 Score: 511.916 bits (1317), Expect = 0.000e+0
Identity = 247/247 (100.00%), Postives = 247/247 (100.00%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI
Sbjct:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247          
BLAST of EMLSAG00000009319 vs. L. salmonis peptides
Match: EMLSAP00000010112 (pep:novel supercontig:LSalAtl2s:LSalAtl2s668:190059:194758:1 gene:EMLSAG00000010112 transcript:EMLSAT00000010112 description:"augustus_masked-LSalAtl2s668-processed-gene-1.1")

HSP 1 Score: 123.25 bits (308), Expect = 1.789e-33
Identity = 92/261 (35.25%), Postives = 136/261 (52.11%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYAT--DIN--EALLKELSNHEGIS---IFKLDVTNKEDVMNAKDSITESI------DILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFI----NRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            M  L GKVALIT A+ GIGR TA+LFAK GA +  T  DI   +   KE     G S   + +  +  +EDV   K  + E+I      DIL N AG +  GSI +   +S+ R   INV S++       P +I+ K  G+I+N+SS+ + I+  P   AY  +K+A+  FTK +A +L   N+RVN + PG + + +L  R   T   ++ Y +F+    N   + R G   E+A  +   A    ++CTG    +DGG
Sbjct:    1 MTNLGGKVALITGASSGIGRSTAILFAKLGATLSITGRDIENLQKTAKECEGQGGTSAPLLIQASLDIEEDV---KRVVEETINRFGRLDILVNNAGILERGSIENTSLESYDRVMNINVRSVFQTTSLATPHLIKTK--GNIVNVSSV-NGIRSFPGVLAYNMSKSALDQFTKCIALELAPKNVRVNSVNPGVIIS-NLHYRAGLT---DEQYEEFLEHSKNTHALGRPGNPDEVAKCIAFFASSESSFCTGVTMPVDGG 251          
BLAST of EMLSAG00000009319 vs. L. salmonis peptides
Match: EMLSAP00000002347 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1446:53993:55015:-1 gene:EMLSAG00000002347 transcript:EMLSAT00000002347 description:"maker-LSalAtl2s1446-augustus-gene-0.15")

HSP 1 Score: 88.9669 bits (219), Expect = 3.607e-21
Identity = 77/263 (29.28%), Postives = 116/263 (44.11%), Query Frame = 0
Query:    4 LDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSN---HEGISIFKLDVTNKEDVMNAKDSITESIDIL---FNCAG-------YVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENK-----KGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQP-MQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            L G V  +T  A G+GR T   F +EGAKV   D+  +   +++    HE      +D+T+ E V NA ++       L    NCAG       Y H  +     ED + +   +N    + + +     + +N+     + G IIN +S+ ++ +G   + AY  +K AV+G T  +A DL    IRVN I PG  DTP L+G       PEK         P   RLG   E A     +  +  +   G   +IDG L +
Sbjct:    2 LKGVVGFVTGGASGLGRATVERFVREGAKVTLVDLPSSEGHKIAQKLGHENCLFQPVDITSPEQVHNALEATRSQFGYLSAVVNCAGIAVGFVTYNHTKATSHGLED-FAKVINVNTIGTFNVIRLAAAQIAKNEPDADNQRGVIINTASV-AAYEGQRGQAAYSASKGAVVGMTLPIARDLASIGIRVNTIAPGLFDTPLLKGL------PEKVRKYLAKTVPNPSRLGDPDEFAHLAQHMVLN--SMMNGEVVRIDGALRM 254          
BLAST of EMLSAG00000009319 vs. L. salmonis peptides
Match: EMLSAP00000010107 (pep:novel supercontig:LSalAtl2s:LSalAtl2s667:334082:336289:1 gene:EMLSAG00000010107 transcript:EMLSAT00000010107 description:"maker-LSalAtl2s667-augustus-gene-2.21")

HSP 1 Score: 78.9518 bits (193), Expect = 2.820e-17
Identity = 63/208 (30.29%), Postives = 103/208 (49.52%), Query Frame = 0
Query:    4 LDGKVALITAAAQGIGRETALLFAKEGAKVYATD--INE------ALLKELSNHEGISIFKLDVTNKEDVMNAKDSITES---IDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVK----HNIRVNCICPGTVDTPSLRGRVNNTPN 196
            ++G  AL+T A  GIGR+ A+  A+ GA +   D  INE       + K+  N +  ++   DV++K+DV  A D I +S   IDIL N AG +     +  D D  +R    N+    ++ +AI+P MI  +  G ++ M+S      G+PN   Y  +K  + G  ++L  +L +    H I +  + P  VDT  ++ R    P+
Sbjct:   96 IEGLNALVTGAGNGIGRQLAIELARNGANIVCLDFLINENEETSAEIKKQFPNIKTWTV-TCDVSSKKDVKLAIDVIKKSVGDIDILINNAGTLCCKPFVQHDFDQIERIISTNLLGQLWVLRAILPQMIA-RDTGYVVAMASFAGH-AGVPNMVPYTASKFGIKGMMEALFIELRQGNRAHGIHLMTVSPFLVDTGMIKNRRVRFPD 300          
BLAST of EMLSAG00000009319 vs. L. salmonis peptides
Match: EMLSAP00000012625 (pep:novel supercontig:LSalAtl2s:LSalAtl2s94:78040:78987:1 gene:EMLSAG00000012625 transcript:EMLSAT00000012625 description:"augustus_masked-LSalAtl2s94-processed-gene-0.5")

HSP 1 Score: 77.7962 bits (190), Expect = 4.498e-17
Identity = 60/227 (26.43%), Postives = 109/227 (48.02%), Query Frame = 0
Query:    8 VALITAAAQGIGRETALLFAKEGAKVYATDIN-----------EALLKELSNHEG--ISIFKLDVTNKEDVMNAKDSITES---IDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHN---IRVNCICPGTVDTPSLRGR---VNNTPNPEKTYTDFINRQPMQR 212
            + LIT  A G G+  A+   K GA V   D+N           E ++  L +     I  +  D+T K+++    + I ++   IDIL N AG +   S+LD  +   + +F++N+ + ++  K+I+PSMI  +K G I+N++S+   + G  N   Y  +K A +G  +++  +L  +    I+ + ICP    T    G    +    NPE+     ++   ++R
Sbjct:   40 IVLITGGASGFGKSLAIKLLKLGANVIIIDVNKKAGDQTLVELEKIISTLPDQLRGFIKFYSCDLTKKDNLYTTLNQIKQNEGDIDILVNNAGVISGSSLLDTPDKKIQLTFDVNIMAHFWTIKSILPSMIRRRK-GHIVNVASMAGLV-GTNNLXDYCASKFAAVGLHEAMRGELFANGNDFIKCSLICPYFASTGMFAGVSTGILPMLNPEEVTDKILDAILLER 264          
BLAST of EMLSAG00000009319 vs. L. salmonis peptides
Match: EMLSAP00000009478 (pep:novel supercontig:LSalAtl2s:LSalAtl2s611:106938:108814:1 gene:EMLSAG00000009478 transcript:EMLSAT00000009478 description:"maker-LSalAtl2s611-augustus-gene-1.12")

HSP 1 Score: 76.6406 bits (187), Expect = 1.054e-16
Identity = 65/209 (31.10%), Postives = 102/209 (48.80%), Query Frame = 0
Query:    4 LDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKEL------SNHEGISIFKLDVTNKEDV--MNAKDSITE----SIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKH----NIRVNCICPGTVDT---PSLRGRVNN 193
            L G+VALIT A  G+GRE +L     G KV   DIN+  ++E           G   F  D++  ++V  +  K S+ E     I +LFN AG  H    L    +  +  F++NV S  Y+ K  +P  ++  K G ++++ SI  SI G  N   Y +TK A+ G T+SL  +L +     ++++    P T+ T   P  + R N+
Sbjct:   49 LFGEVALITGAGGGLGRELSLQLTDLGVKVICVDINKVSVEETCRITQKKGSLGSRAFVCDISVPKEVGDLVKKISLLEDELGPITMLFNNAGIAHCKPFLKHTNEEIQSLFQVNVISHMYLIKEYLPKFLDANK-GHLVSIGSIAGSI-GTANLVPYCSTKYAIRGLTESLFMELREMYPNTSVKMTTAHPYTISTSLIPKPKNRFNS 255          
BLAST of EMLSAG00000009319 vs. L. salmonis peptides
Match: EMLSAP00000008813 (pep:novel supercontig:LSalAtl2s:LSalAtl2s549:453537:455976:-1 gene:EMLSAG00000008813 transcript:EMLSAT00000008813 description:"maker-LSalAtl2s549-augustus-gene-4.8")

HSP 1 Score: 71.2478 bits (173), Expect = 1.796e-14
Identity = 52/194 (26.80%), Postives = 87/194 (44.85%), Query Frame = 0
Query:   52 ISIFKLDVTNKE-DVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            + + K   + KE +V++   S   ++D L N  G        D     W    E N++  Y M +    + +  K GGSI+N+  I  + +G P     G  +AAV   TK+LA +  ++ IRVNC+ PG V + +     +        ++    + P +R GT  E++S V  L     ++  G    +DGG
Sbjct:  223 VCVVKPKSSRKESNVIDKVASEFGTLDFLVNNGGGQFPSLAADMSLKGWNAVIETNLNGTYLMSREAY-NQVFKKSGGSIVNI--IAQTSRGFPMMAHTGAARAAVENLTKTLALEWSENGIRVNCVAPGPVFSKTASDNYS-----YDLFSSLTPKLPTKRCGTPDEVSSTVCFLLSPGASFVNGATLVVDGG 408          
BLAST of EMLSAG00000009319 vs. L. salmonis peptides
Match: EMLSAP00000009346 (pep:novel supercontig:LSalAtl2s:LSalAtl2s598:262505:268264:1 gene:EMLSAG00000009346 transcript:EMLSAT00000009346 description:"maker-LSalAtl2s598-augustus-gene-2.22")

HSP 1 Score: 65.855 bits (159), Expect = 7.408e-14
Identity = 44/143 (30.77%), Postives = 68/143 (47.55%), Query Frame = 0
Query:  103 FEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGL 245
             +INV   + + K +VPS+  N    SII +SSI   +  +P    Y  +K A+I  +K+L+ +L    IRVNC+ PG V T       +N    +      +   P++R     EI+  V  LA  + +Y TG      GG+
Sbjct:    1 MDINVKVPFLLAKEMVPSL-NNXPDPSIIFISSIAGYVP-MPMLGPYSISKTALISLSKTLSNELGPQGIRVNCVAPGIVKTKFASALTDN----DSIAKMALANIPLKRFAVPDEISGIVAFLASKDASYMTGETIVASGGM 137          
BLAST of EMLSAG00000009319 vs. L. salmonis peptides
Match: EMLSAP00000010216 (pep:novel supercontig:LSalAtl2s:LSalAtl2s679:144940:154519:1 gene:EMLSAG00000010216 transcript:EMLSAT00000010216 description:"maker-LSalAtl2s679-augustus-gene-1.45")

HSP 1 Score: 61.6178 bits (148), Expect = 3.852e-11
Identity = 56/205 (27.32%), Postives = 88/205 (42.93%), Query Frame = 0
Query:   10 LITAAAQGIGRETALLFAKEGAKVYA---------TDINEALLKELSNHEGISIFKLDVTN---------KEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMI-ENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTP 195
            LIT  + GIG+ TA    K G  +            D  E ++KE      ++IF +DVT          +E + +  D     + ++ +CAG    G+I D   + +     IN      + K ++P +  ENK+  S I + S  + + GL    AY  +K A+ GF +SL  ++  H I V    P   DTPS      + P
Sbjct:  530 LITGGSSGIGKATAKEVLKRGTSLVTLWARNKGKLEDAREEIIKETGGR--VNIFSVDVTGGLSGIHNVFEETIRDGGD-----LRMVIHCAGSSMAGTIEDTSIEDYNCMMNINYFGTVNVTKVVLPHLKKENKEIPSRITLISSIAGVMGLYGFTAYSASKFALRGFAESLEMEVRPHGISVTLNLPPDTDTPSFAEENKSKP 727          
BLAST of EMLSAG00000009319 vs. L. salmonis peptides
Match: EMLSAP00000010213 (pep:novel supercontig:LSalAtl2s:LSalAtl2s679:139734:140720:-1 gene:EMLSAG00000010213 transcript:EMLSAT00000010213 description:"augustus_masked-LSalAtl2s679-processed-gene-1.4")

HSP 1 Score: 59.3066 bits (142), Expect = 4.084e-11
Identity = 48/184 (26.09%), Postives = 86/184 (46.74%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSN------HEGISIFKLDVTNKEDVMNAKDSITE---SIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVN 175
            M  L  K+ LIT A+ GIG  TAL FA  G+K+      +  L+ +S        + +     D+++ E      D        +D++ N AG ++   + +   + +  S  +N+ S     +     + ++KK  +I+N+SSI + ++  P   AY  +KA +   T+  A +L+   IRVN
Sbjct:    1 MSGLGKKIVLITGASGGIGEGTALHFASLGSKLSLVARRKEELERVSEACKAKGAQDVIYTVQDLSSGEACSACVDETFNYYGGLDVVVNNAGVMYGQKLQEVTPEIFDHSMNLNIHSALRXTQXATKYLEKSKKQPAIVNVSSI-AGLRAFPGALAYKISKAGLDQMTRCTALELISKGIRVN 183          
BLAST of EMLSAG00000009319 vs. SwissProt
Match: gi|110808203|sp|Q3T046.1|BDH2_BOVIN (RecName: Full=3-hydroxybutyrate dehydrogenase type 2; AltName: Full=Dehydrogenase/reductase SDR family member 6; AltName: Full=R-beta-hydroxybutyrate dehydrogenase)

HSP 1 Score: 280.411 bits (716), Expect = 1.548e-94
Identity = 139/247 (56.28%), Postives = 173/247 (70.04%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV ++TAAAQGIGR  AL FAKEGAKV ATDIN++ L+EL  + GI    LDVT K+ +    + I E +D+LFN AG+VHHG+ILDC+E  W  S  +NV SMY M KA +P M+  +K G+IINMSS+ SSIKG+ NR  Y TTKAAVIG TKS+A D ++  IR NC+CPGTVDTPSL+ R+   PNPE+  +DF+ RQ   R  T+ E+A   + LA D  AY TG    IDGG S+
Sbjct:    1 MGRLDGKVIVLTAAAQGIGRAAALAFAKEGAKVIATDINDSKLQELDKYPGIHTRVLDVTKKKQIDQFANDI-ERLDVLFNVAGFVHHGTILDCEETDWDFSMNLNVRSMYLMIKAFLPKMMA-QKSGNIINMSSVASSIKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARPNPEEALSDFLKRQKTGRFATAEEVALLCVYLASDESAYITGNPVIIDGGWSL 245          
BLAST of EMLSAG00000009319 vs. SwissProt
Match: gi|123913584|sp|Q3KPT7.1|BDH2_XENLA (RecName: Full=3-hydroxybutyrate dehydrogenase type 2; AltName: Full=R-beta-hydroxybutyrate dehydrogenase)

HSP 1 Score: 278.87 bits (712), Expect = 6.267e-94
Identity = 136/247 (55.06%), Postives = 173/247 (70.04%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV +++AAAQGIGR  A+ FAKEGA+V ATD+NE  LKEL  ++GI    LDVT K+ + N    I + ID+LFN AG+VHHG+ILDC E  W  +  +NV SMY+M K  +P M+  +K G+IINMSS+ SSIKG+ NR  Y T+KAAVIG TKS+A D +   IR NCICPGTVDTPSLR R+   P+PE+   DF+ RQ   R+ T+ E+A   + LA D  AY TG ++ IDGG S+
Sbjct:    1 MGRLDGKVIVLSAAAQGIGRAAAIAFAKEGAQVIATDVNEMKLKELEAYKGIQTRVLDVTKKDQIENLCKEI-DRIDVLFNVAGFVHHGTILDCTEADWDFTMNVNVRSMYFMIKTFLPKMLA-QKSGNIINMSSVASSIKGVVNRCVYSTSKAAVIGLTKSVASDFIDQGIRCNCICPGTVDTPSLRERIQARPDPEQALKDFLARQRTGRMATAEEVAHLCVYLASDESAYVTGNEHIIDGGWSL 245          
BLAST of EMLSAG00000009319 vs. SwissProt
Match: gi|306531055|sp|D4A1J4.2|BDH2_RAT (RecName: Full=3-hydroxybutyrate dehydrogenase type 2; AltName: Full=Dehydrogenase/reductase SDR family member 6; AltName: Full=R-beta-hydroxybutyrate dehydrogenase)

HSP 1 Score: 274.633 bits (701), Expect = 2.747e-92
Identity = 136/247 (55.06%), Postives = 170/247 (68.83%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRL+GKV ++TAAAQGIGR +AL FA+EGAKV ATDINEA L+EL N+ GI    LDVT K  +      I E ID+LFN AG+VHHG+ILDC+E  W  S  +NV SMY M KA +P M+  +K G+IINMSS+ SSIKG+ NR  Y  TKAAVIG TKS+A D ++  IR NC+CPGTVDTPSL+ R+    +P++    F+NRQ   R  ++ E+A   + LA D  AY TG    IDGG S+
Sbjct:    1 MGRLEGKVIVLTAAAQGIGRASALAFAREGAKVIATDINEAKLQELENYPGIQTRVLDVTKKRQIDQFASEI-EKIDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLA-QKSGNIINMSSVASSIKGVENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARDDPKEALKAFLNRQKTGRFASAEEVALLCVYLASDESAYVTGTPVVIDGGWSL 245          
BLAST of EMLSAG00000009319 vs. SwissProt
Match: gi|77416417|sp|Q8JZV9.1|BDH2_MOUSE (RecName: Full=3-hydroxybutyrate dehydrogenase type 2; AltName: Full=Dehydrogenase/reductase SDR family member 6; AltName: Full=R-beta-hydroxybutyrate dehydrogenase)

HSP 1 Score: 274.248 bits (700), Expect = 4.394e-92
Identity = 135/247 (54.66%), Postives = 170/247 (68.83%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV ++TAAAQGIGR +AL FA+EGAKV ATDINE+ L+EL ++ GI    LDVT K  +      I E ID+LFN AG+VHHG+ILDC+E  W  S  +NV SM+ M KA +P M+  +K G+IINMSS+ SSIKG+ NR  Y  TKAAVIG TKS+A D ++  IR NC+CPGTVDTPSL+ R+    NP++    F+NRQ   R  ++ E+A   + LA D  AY TG    IDGG S+
Sbjct:    1 MGRLDGKVIVLTAAAQGIGRASALAFAREGAKVIATDINESKLQELESYRGIQTRVLDVTKKRQIDQFASEI-ERIDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMFLMIKAFLPKMLA-QKSGNIINMSSVASSIKGVENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARDNPKEALKTFLNRQKTGRFASAEEVALLCVYLASDESAYVTGNPVIIDGGWSL 245          
BLAST of EMLSAG00000009319 vs. SwissProt
Match: gi|306531048|sp|C1C4R8.1|BDH2_LITCT (RecName: Full=3-hydroxybutyrate dehydrogenase type 2; AltName: Full=R-beta-hydroxybutyrate dehydrogenase)

HSP 1 Score: 272.707 bits (696), Expect = 1.577e-91
Identity = 135/247 (54.66%), Postives = 171/247 (69.23%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV +++A AQGIG+  A+ FAKEGAKV ATDIN   LKEL +++GI    LDVT K+ +      I + ID+LFN AG+VHHGSILDC+E  W  +  +NV SMY M K  +P M+  +K G+IINMSS+ SSIKG+ NR  Y T+KAAVIG TKS+A D ++  IR NCICPGTVDTPSLR R+   P+PE+   DF+ RQ   R+ T+ E+A   + LA D  AY TG  + IDGG S+
Sbjct:    1 MGRLDGKVIVLSAGAQGIGKAAAIAFAKEGAKVIATDINGEKLKELESYKGIETRVLDVTKKDQIEKLSKEI-DRIDVLFNVAGFVHHGSILDCEEADWDFTMNVNVRSMYLMIKTFLPKMLA-QKSGNIINMSSVASSIKGVVNRCVYSTSKAAVIGLTKSVAADFIEQGIRCNCICPGTVDTPSLRERIEARPDPEQALKDFLARQKTGRMCTAEEVAHLCVYLASDEAAYVTGNAHIIDGGWSL 245          
BLAST of EMLSAG00000009319 vs. SwissProt
Match: gi|82193321|sp|Q561X9.1|BDH2_DANRE (RecName: Full=3-hydroxybutyrate dehydrogenase type 2; AltName: Full=R-beta-hydroxybutyrate dehydrogenase)

HSP 1 Score: 264.233 bits (674), Expect = 3.087e-88
Identity = 134/248 (54.03%), Postives = 172/248 (69.35%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDV-MNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV +++AAAQGIG+ +A+ FAKEGA+V ATDIN   LKEL    GI    +DVT K+ V   AKD   + +D+LFN AG+VHHGSILDC+E  W  +  +NV SMY M KA +P M+  +K G+IINM+S+ SSIKG+ NR  Y T+KAAVIG TKS+A D ++  IR NCICPGTVDTPSLR R+   P+PE+ + DF+ RQ   RL T+ E+A   + LA D   + TG +  IDGG  +
Sbjct:    1 MGRLDGKVIVLSAAAQGIGKASAIAFAKEGAQVTATDINGEKLKELDGIPGIKTKVVDVTKKDQVDALAKD--FDHVDVLFNIAGFVHHGSILDCEESDWDFTMNVNVRSMYLMIKAFLPKMLA-RKSGNIINMASVASSIKGVVNRCVYSTSKAAVIGLTKSVAADFLEQGIRCNCICPGTVDTPSLRERIQARPDPEQAFKDFMARQRTGRLCTAEEVAHLCVYLASDESTFVTGTEVIIDGGWRL 245          
BLAST of EMLSAG00000009319 vs. SwissProt
Match: gi|125987797|sp|Q9BUT1.2|BDH2_HUMAN (RecName: Full=3-hydroxybutyrate dehydrogenase type 2; AltName: Full=Dehydrogenase/reductase SDR family member 6; AltName: Full=Oxidoreductase UCPA; AltName: Full=R-beta-hydroxybutyrate dehydrogenase; AltName: Full=Short chain dehydrogenase/reductase family 15C member 1)

HSP 1 Score: 256.529 bits (654), Expect = 3.415e-85
Identity = 135/247 (54.66%), Postives = 171/247 (69.23%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV ++TAAAQGIG+  AL FA+EGAKV ATDINE+ L+EL  + GI    LDVT K+ +    + + E +D+LFN AG+VHHG++LDC+E  W  S  +NV SMY M KA +P M+  +K G+IINMSS+ SS+KG+ NR  Y TTKAAVIG TKS+A D ++  IR NC+CPGTVDTPSL+ R+    NPE+   DF+ RQ   R  T+ EIA   + LA D  AY TG    IDGG S+
Sbjct:    1 MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQTRVLDVTKKKQIDQFANEV-ERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLA-QKSGNIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL 245          
BLAST of EMLSAG00000009319 vs. SwissProt
Match: gi|81792293|sp|Q8P3K4.1|FUCDH_XANCP (RecName: Full=2-keto-3-deoxy-L-fuconate dehydrogenase)

HSP 1 Score: 249.21 bits (635), Expect = 1.376e-81
Identity = 133/246 (54.07%), Postives = 165/246 (67.07%), Query Frame = 0
Query:    3 RLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNH-EGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKT-YTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLS 246
            RL GK  LITAA  GIGRE+AL  A+ GA V ATDI+ A L+ L+   + I+   LDVT+   +     +     D+LFNCAGYVH GSILDCDE +W+RSF INVD+MYY CKA++P M+E  +G SIINMSS+ SSIKG+PNRF YG TKAAVIG +K++A D V   +R N ICPGT+ TPSL  RV      E+  +  F +RQPM RLG   EIA  V+ LA D  ++ TG  + IDGG S
Sbjct:   56 RLQGKRCLITAAGAGIGRESALACARAGAHVIATDIDAAALQALAAESDAITTQLLDVTDAAAITALV-AAHGPFDVLFNCAGYVHQGSILDCDEPAWRRSFSINVDAMYYTCKAVLPGMLERGRG-SIINMSSVASSIKGVPNRFVYGVTKAAVIGLSKAIAADYVAQGVRCNAICPGTIKTPSLGQRVQALGGDEQAVWKSFTDRQPMGRLGDPREIAQLVVYLASDESSFTTGQTHIIDGGWS 299          
BLAST of EMLSAG00000009319 vs. SwissProt
Match: gi|6919838|sp|Q9X248.1|FABG_THEMA (RecName: Full=3-oxoacyl-[acyl-carrier-protein] reductase FabG; AltName: Full=3-ketoacyl-acyl carrier protein reductase; AltName: Full=Beta-Ketoacyl-acyl carrier protein reductase; AltName: Full=Beta-ketoacyl-ACP reductase)

HSP 1 Score: 162.925 bits (411), Expect = 2.044e-48
Identity = 95/253 (37.55%), Postives = 142/253 (56.13%), Query Frame = 0
Query:    3 RLDGKVALITAAAQGIGRETALLFAKEGAKVYATDIN----EALLKELSNHEG-ISIFKLDVTNKEDVMNAKDSITES---IDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            RL+GKV LIT AA GIG+ T LLFA+EGA V A DI+    ++L+KE     G +  + L+VT+++ +    + + +    ID+L N AG      ++   E+ W     +N+  ++ + + +VP MI+ ++ GSI+N+SS+   I G P +  Y  +KA VIG TK+ A +L   NIRVN + PG ++TP           PEK     ++R P+ R G   E+A  +L LA D  +Y TG    IDGGL I
Sbjct:    2 RLEGKVCLITGAASGIGKATTLLFAQEGATVIAGDISKENLDSLVKEAEGLPGKVDPYVLNVTDRDQIKEVVEKVVQKYGRIDVLVNNAGITRDALLVRMKEEDWDAVINVNLKGVFNVTQMVVPYMIK-QRNGSIVNVSSVV-GIYGNPGQTNYAASKAGVIGMTKTWAKELAGRNIRVNAVAPGFIETPMTEKL------PEKARETALSRIPLGRFGKPEEVAQVILFLASDESSYVTGQVIGIDGGLVI 246          
BLAST of EMLSAG00000009319 vs. SwissProt
Match: gi|6831715|sp|Q9WYG0.1|Y325_THEMA (RecName: Full=Uncharacterized oxidoreductase TM_0325)

HSP 1 Score: 162.54 bits (410), Expect = 2.623e-48
Identity = 95/247 (38.46%), Postives = 133/247 (53.85%), Query Frame = 0
Query:    4 LDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSN------HEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
              GKV LIT A  GIG++ A++FA+ GAKV   DI+E   KE          E   IF     + E ++         +DIL N AG V +G+I +  E+ + ++  +NV   + + K  V  M + + GG I+N+SS    I G+P R  Y  +KAA++G T+SLA D V + IRVN +CPGT  +  L  RV  +PNPE+      +R PM+RLG   EIA  +L  A D   + TG    IDGG
Sbjct:    3 FQGKVVLITGAGSGIGKKAAVMFAERGAKVAINDISEEKGKETVELIKSMGGEAAFIFGDVAKDAEQIVKKTVETFGRLDILVNNAGIVPYGNIEETSEEDFDKTMAVNVKGPFLLSKYAVEQM-KKQGGGVIVNVSSEAGLI-GIPRRCVYSVSKAALLGLTRSLAVDYVDYGIRVNAVCPGTTQSEGLMARVKASPNPEELLKKMTSRIPMKRLGKEEEIAFAILFAACDEAGFMTGSIINIDGG 247          
BLAST of EMLSAG00000009319 vs. Select Arthropod Genomes
Match: gb|KFM72093.1| (Estradiol 17-beta-dehydrogenase 8, partial [Stegodyphus mimosarum])

HSP 1 Score: 139.813 bits (351), Expect = 8.387e-40
Identity = 94/252 (37.30%), Postives = 131/252 (51.98%), Query Frame = 0
Query:    4 LDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKE----LSNHEGISIFKLDVTNKEDVMNAKDSITES---IDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENK-KGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            L G++ALIT    GIGR   L FAKEGA V +TDINE  +KE    L +        +DV++ E V N    I  +    + L NCAG      +LD  E  +    ++N+   Y M +A    MIE K   G+I+N+SSI   I G   +  Y  +K  V GFTK++A +L K+NIR N + PG +DTP ++        P+K         P++RLGT  EIA   + LA    +Y TGG  ++ GGL +
Sbjct:    5 LQGRIALITGGGSGIGRAVCLSFAKEGAIVISTDINEDAIKETVRSLPDAGKHFAEAVDVSDSESVTNLMAKIKRNSLFPNTLVNCAGITRDTLMLDMTEAMFDDVIKVNLKGTYLMTQAFSKLMIEAKVDDGAIVNISSISGKI-GNFGQCNYAASKTGVEGFTKTVARELAKYNIRCNAVMPGFIDTPMVKSV------PDKVMDRIKKEIPLKRLGTPEEIADVCVFLASRRSSYITGGIIQVSGGLHM 249          
BLAST of EMLSAG00000009319 vs. Select Arthropod Genomes
Match: AGB95045.1 (CG3603, isoform B [Drosophila melanogaster])

HSP 1 Score: 134.035 bits (336), Expect = 1.592e-37
Identity = 84/254 (33.07%), Postives = 132/254 (51.97%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDIN----EALLKELSNHEGISIFKLDVTNKEDVM----NAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENK-KGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGL 245
            +G L GKVAL+T A  GIGR T  L A++GAKV A D N    +  ++EL +    ++ ++DV++ + V      A     ++  I+ N AG    G +L   E  +   + +N+   + + +A   +MIE K + G+I+N+SSI + +  +  +  Y  TKA VI FT+  + +  K  IRVNCI PG +DTP +         P+    + + R P+ RLG   EIA  +  LA    +Y  G   ++ GGL
Sbjct:    3 VGVLAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAAL-EVDVSSAQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQKLENGTIVNLSSIVAKMNNV-GQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPMV------AVVPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGL 248          
BLAST of EMLSAG00000009319 vs. Select Arthropod Genomes
Match: AAF45844.2 (CG3603, isoform A [Drosophila melanogaster])

HSP 1 Score: 134.035 bits (336), Expect = 1.592e-37
Identity = 84/254 (33.07%), Postives = 132/254 (51.97%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDIN----EALLKELSNHEGISIFKLDVTNKEDVM----NAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENK-KGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGL 245
            +G L GKVAL+T A  GIGR T  L A++GAKV A D N    +  ++EL +    ++ ++DV++ + V      A     ++  I+ N AG    G +L   E  +   + +N+   + + +A   +MIE K + G+I+N+SSI + +  +  +  Y  TKA VI FT+  + +  K  IRVNCI PG +DTP +         P+    + + R P+ RLG   EIA  +  LA    +Y  G   ++ GGL
Sbjct:    3 VGVLAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAAL-EVDVSSAQSVQFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQKLENGTIVNLSSIVAKMNNV-GQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPMV------AVVPDSVKQEVVQRCPLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGGL 248          
BLAST of EMLSAG00000009319 vs. Select Arthropod Genomes
Match: EAA07681.6 (AGAP002520-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 124.405 bits (311), Expect = 9.000e-34
Identity = 83/251 (33.07%), Postives = 135/251 (53.78%), Query Frame = 0
Query:    4 LDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKL--DVTNKED---VMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPG-TVDTPSLRGRVNNTPNPEKTYTDFI----NRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            L GKV LIT A+ GIG  TAL F++ GA +  T      L E+++  G S F +  D++ + D   V+ A       +D+L N AG +  G+I     + + R    N+ ++Y++    VP +++++  G+++N+SS+ + I+  P   AY  +K AV  FT+ +A +L    +RVNC+ PG TV     RG ++     E+TY  F+    N   M R G ++E+A  ++ LA D  ++ TG    IDGG
Sbjct:    3 LAGKVVLITGASSGIGAATALKFSQLGASLALTGRKLDNLNEVASQCGGSPFVVAGDISKEADTERVLKATIEKYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNIRAVYHLTMLAVPHLLQSQ--GNVVNVSSV-NGIRSFPGVLAYNISKMAVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHKRGGMD-----EQTYAKFLEHSKNTHAMGRPGQASEVADAIVFLASDAASFITGASLPIDGG 245          
BLAST of EMLSAG00000009319 vs. Select Arthropod Genomes
Match: gb|KFM80662.1| (Dehydrogenase/reductase SDR family member 4, partial [Stegodyphus mimosarum])

HSP 1 Score: 124.79 bits (312), Expect = 1.283e-33
Identity = 84/251 (33.47%), Postives = 138/251 (54.98%), Query Frame = 0
Query:    3 RLDGKVALITAAAQGIGRETALLFAKEGAKVYAT-----DINEALLKELSNHEGISIFKLDVTNKED---VMNAKDSITESIDILF-NCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            +L GKVA++TA+ +GIG   A   A +GA V  +     ++++A+    +  + +S     V N ED   +++   +    IDIL  N A       +LD  E++W + F+INV + + + +A+VP ++E + GGSI+ +SSI ++ K +    AY  +K  ++G TK+ A   V  NIRVNC+CPG ++T   +G  +N P+ ++    FI   PM+R+G   E A  V  L  D+ +Y TG    + GG
Sbjct:   29 KLLGKVAIVTASTEGIGFAIAKRLANDGASVVISSRKKENVDKAISDIKTVSDNVSGITCHVGNSEDRKLLLDFAVAKYGGIDILVSNAAVNPVMCQVLDTPEEAWDKIFDINVKAAFLLTQAVVP-LMEQRGGGSIVYVSSI-AAYKPMEVIGAYSVSKTTLLGLTKAAAAQCVSQNIRVNCVCPGIIETKFSKGLWSN-PSSKELLHQFI---PMRRIGKPDECAGIVSFLCSDDASYITGESIAVAGG 273          
BLAST of EMLSAG00000009319 vs. Select Arthropod Genomes
Match: gb|EFA08221.1| (L-xylulose reductase-like Protein [Tribolium castaneum])

HSP 1 Score: 122.479 bits (306), Expect = 3.763e-33
Identity = 83/240 (34.58%), Postives = 121/240 (50.42%), Query Frame = 0
Query:    6 GKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNH-EGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            GK AL+T A+QGIGR+     AK GAKV A   N+ LL+ L      I I   D+++     NA   +  S D+L N AG      +    E    + F INV ++  + K +   +++    GSI+N+SS  +S+ GL N   Y +TK AV  FT++ A +L  HNIRVNC+ P  + T    GR+  +    K     + + P++R G   E+   VL L  D  +  TG    +DGG
Sbjct:    7 GKTALVTGASQGIGRDIVKQLAKGGAKVVAVARNKELLESLKEEVPSIEIIPCDLSDWNATQNALSHL--SPDLLVNNAGLAILKPLTRVSESDVDQLFAINVKALIQVTKLVTEKLLQRGVSGSIVNISS-QASMAGLLNHSVYCSTKGAVDAFTRAAALELGPHNIRVNCVNPTVIMTA--MGRLGWS--EPKVAEPMLQKIPLRRFGEVQEVVDAVLFLLSDKASMITGTCLPVDGG 239          
BLAST of EMLSAG00000009319 vs. Select Arthropod Genomes
Match: XP_006558481.1 (PREDICTED: estradiol 17-beta-dehydrogenase 8 [Apis mellifera])

HSP 1 Score: 122.479 bits (306), Expect = 4.269e-33
Identity = 77/250 (30.80%), Postives = 124/250 (49.60%), Query Frame = 0
Query:    6 GKVALITAAAQGIGRETALLFAKEGAKVYATDIN----EALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESID----ILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIEN--KKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGL 245
            GK+A +T A  GIGR+   + AK+GA V ATDIN    E  ++ L++   +++  ++V N++ +  A  ++         I+ N AG      IL    + + +   +N+   +++ +  V  MI     KGGSI+N+SSI   I G   +  Y  +KA VI  TK+ + +  +  IRVN + PG ++TP  +        PE     FI R P+ R+G   E+A  +  LA    +Y  G    + GGL
Sbjct:    4 GKIAFVTGAGSGIGRKVCHILAKQGASVIATDINLKNAEETIRSLNDSRHLAL-NVEVLNEQSIKEAFKNVINKYSTPPTIIVNSAGITSDQFILKLTNEDFDKVLNVNLKGTFFIIQTAVKEMINANVNKGGSIVNISSIIGKI-GNMGQANYAASKAGVIALTKTASLEFGQFGIRVNTVLPGFIETPMTKTI------PENIKQLFIKRIPLHRMGKPEEVAEVISFLASSKSSYINGASIDVTGGL 245          
BLAST of EMLSAG00000009319 vs. Select Arthropod Genomes
Match: XP_006562411.1 (PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like isoform X1 [Apis mellifera])

HSP 1 Score: 122.094 bits (305), Expect = 7.646e-33
Identity = 82/245 (33.47%), Postives = 127/245 (51.84%), Query Frame = 0
Query:    6 GKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNH---EGISIFKLDVTNKEDVMNAKDSITE---SIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            GKV LIT A+ GIG  TA+ F+K  A +  T  N   L E+++        I   D+TN+ DV N   S  +    +DIL N AG + +GSI +   + + R F INV S+Y++    VP +I+ K  G+I+N+SS+   ++  P   +Y  +K+A+  FT+ +A +L    +RVN + PG + T   R    +    +  Y    N   + R G   E+A  +  LA D+ ++ TG    IDGG
Sbjct:    5 GKVVLITGASSGIGAATAIHFSKLDALLSITGRNVQKLNEIADQCKSNKPLIIPGDLTNETDVQNIIKSTIKHYGKLDILINNAGILENGSIENTSLEQYDRIFNINVRSIYHLTMLAVPHIIQTK--GNIVNVSSVVG-LRSFPGVLSYCMSKSAIDQFTRCVAVELAPKQVRVNAVNPGVITTNLHRNSGMSDEELKNFYEHCKNTHALGRSGDVNEVAKAIAYLASDDASFITGVTLSIDGG 246          
BLAST of EMLSAG00000009319 vs. Select Arthropod Genomes
Match: EGK96869.1 (AGAP002521-PB [Anopheles gambiae str. PEST])

HSP 1 Score: 122.094 bits (305), Expect = 8.749e-33
Identity = 87/253 (34.39%), Postives = 131/253 (51.78%), Query Frame = 0
Query:    6 GKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNH-EGIS-----IFKLDVTNKEDVMNAKDSITE---SIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTP-SLRGRVNNTPNPEKTYTDFINR----QPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            GKV LIT A+ GIG  TA+ FAK GA +  T  NEA LK++ +  E  S     +   DVT +ED     D I      +D+L N AG + +GSI +     +      NV  +Y++    VP +IE K  G+I+N+SS+  + +  P   AY  +KAA+  FT+  A +L    +RVN + PG + T    RG ++     E++Y  F+ +      + R G + E+AS +  LA D  ++ TG    +DGG
Sbjct:    5 GKVVLITGASSGIGEGTAIYFAKFGASLALTGRNEANLKKVGDACEAQSKSKPLLIVADVTKEEDNKRVLDEIVAKYGKLDVLVNNAGILGNGSIENTSLQQYDELMNTNVRGVYHLTMLAVPLLIETK--GNIVNLSSVAGN-RSFPGILAYSMSKAAIDQFTRCTALELAPKQVRVNAVNPGVIITDIHKRGGMD-----EESYAAFLKKCEQTHALGRPGVAEEVASTIAFLASDGASFITGVTLNVDGG 249          
BLAST of EMLSAG00000009319 vs. Select Arthropod Genomes
Match: EAA07469.4 (AGAP002521-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 122.094 bits (305), Expect = 8.749e-33
Identity = 87/253 (34.39%), Postives = 131/253 (51.78%), Query Frame = 0
Query:    6 GKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNH-EGIS-----IFKLDVTNKEDVMNAKDSITE---SIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTP-SLRGRVNNTPNPEKTYTDFINR----QPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            GKV LIT A+ GIG  TA+ FAK GA +  T  NEA LK++ +  E  S     +   DVT +ED     D I      +D+L N AG + +GSI +     +      NV  +Y++    VP +IE K  G+I+N+SS+  + +  P   AY  +KAA+  FT+  A +L    +RVN + PG + T    RG ++     E++Y  F+ +      + R G + E+AS +  LA D  ++ TG    +DGG
Sbjct:    5 GKVVLITGASSGIGEGTAIYFAKFGASLALTGRNEANLKKVGDACEAQSKSKPLLIVADVTKEEDNKRVLDEIVAKYGKLDVLVNNAGILGNGSIENTSLQQYDELMNTNVRGVYHLTMLAVPLLIETK--GNIVNLSSVAGN-RSFPGILAYSMSKAAIDQFTRCTALELAPKQVRVNAVNPGVIITDIHKRGGMD-----EESYAAFLKKCEQTHALGRPGVAEEVASTIAFLASDGASFITGVTLNVDGG 249          
BLAST of EMLSAG00000009319 vs. nr
Match: gi|225709498|gb|ACO10595.1| (3-hydroxybutyrate dehydrogenase type 2 [Caligus rogercresseyi])

HSP 1 Score: 404.445 bits (1038), Expect = 3.591e-141
Identity = 194/248 (78.23%), Postives = 219/248 (88.31%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMN-AKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKVA ITAAAQGIGRETA+LFAKEGAKV ATD N ++LKEL+++ GI++++LDVT ++ +   AK    E IDILFNCAGYVHHGS+LDC+E+ WKRSFEINVDSM+Y+ KA VP MI   KGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLV H IRVNCICPGTVDTPSLRGRVNN+ +PE+ Y +FINRQP+ RLGTS EIASFVLTLAEDNG+YCTGG+YKIDGGLSI
Sbjct:    1 MGRLDGKVAFITAAAQGIGRETAILFAKEGAKVIATDFNASVLKELTSYPGINVYELDVTKRDKIDQLAKRLDGEDIDILFNCAGYVHHGSMLDCEEEDWKRSFEINVDSMFYVSKAFVPKMISRGKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVPHKIRVNCICPGTVDTPSLRGRVNNSQDPEEAYRNFINRQPLGRLGTSLEIASFVLTLAEDNGSYCTGGEYKIDGGLSI 248          
BLAST of EMLSAG00000009319 vs. nr
Match: gi|225718134|gb|ACO14913.1| (3-hydroxybutyrate dehydrogenase type 2 [Caligus clemensi])

HSP 1 Score: 378.637 bits (971), Expect = 7.054e-131
Identity = 181/247 (73.28%), Postives = 203/247 (82.19%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRL+GKVALITAAAQGIGRETA+ FA EGAKV ATD+N   L ELS    I  + LD T+K  +    D +   IDILFNC G+V HGSILDCDED W+ SF++NVDSMYY+CKA +P MI   KGGSIINMSSICSS+KGLPNRFAYGTTKAAVIG TKSLA DLV H IRVNCICPGTVDTPSLRGRVNN  +P+K Y +FI RQP+QRLGT +EIASFVLTLAED+GAYCTGG++KIDGGLSI
Sbjct:    1 MGRLEGKVALITAAAQGIGRETAIRFASEGAKVIATDVNSDKLSELSAIPSIETYTLDATDKIRINEFADLLEVDIDILFNCVGFVAHGSILDCDEDDWRASFQVNVDSMYYVCKAFIPKMINRGKGGSIINMSSICSSLKGLPNRFAYGTTKAAVIGLTKSLAIDLVSHKIRVNCICPGTVDTPSLRGRVNNAEDPKKAYKNFIQRQPLQRLGTPSEIASFVLTLAEDDGAYCTGGEFKIDGGLSI 247          
BLAST of EMLSAG00000009319 vs. nr
Match: gi|908484099|ref|XP_013092993.1| (PREDICTED: 3-hydroxybutyrate dehydrogenase type 2-like isoform X2 [Biomphalaria glabrata] >gi|908484103|ref|XP_013092994.1| PREDICTED: 3-hydroxybutyrate dehydrogenase type 2-like isoform X2 [Biomphalaria glabrata])

HSP 1 Score: 297.36 bits (760), Expect = 8.389e-99
Identity = 144/247 (58.30%), Postives = 176/247 (71.26%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV +++AA QGIG+  AL+ AKEGAKV ATD+N  LLK+L    GI    LDV NK+++    +S+ +S+D+LFNCAG+VHHG++LDC E  W  SF +NV S+Y MC   VP +I   +GGSIINM+S+ SSIKG PNRF YG TKAAVIG  KSLA D V+H IR N ICPGTVDTPSLR R+    +PE+ Y DFI RQ + RLGT  EIA  V+ LA D   + TG D+ IDGG SI
Sbjct:    1 MGRLDGKVFVLSAAGQGIGKAVALMAAKEGAKVIATDVNGELLKQLEGVPGIQTQVLDVLNKQEIEKFANSL-DSVDVLFNCAGFVHHGTLLDCAEKDWDFSFNLNVKSVYTMCSYFVPKLIAQGRGGSIINMASVVSSIKGAPNRFVYGATKAAVIGLNKSLAVDFVQHKIRFNTICPGTVDTPSLRDRMAAQGDPEQAYKDFIARQKLGRLGTPDEIAYLVVYLASDESNFVTGQDFIIDGGWSI 246          
BLAST of EMLSAG00000009319 vs. nr
Match: gi|908484096|ref|XP_013092992.1| (PREDICTED: 3-hydroxybutyrate dehydrogenase type 2-like isoform X1 [Biomphalaria glabrata])

HSP 1 Score: 296.975 bits (759), Expect = 1.549e-98
Identity = 144/247 (58.30%), Postives = 176/247 (71.26%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV +++AA QGIG+  AL+ AKEGAKV ATD+N  LLK+L    GI    LDV NK+++    +S+ +S+D+LFNCAG+VHHG++LDC E  W  SF +NV S+Y MC   VP +I   +GGSIINM+S+ SSIKG PNRF YG TKAAVIG  KSLA D V+H IR N ICPGTVDTPSLR R+    +PE+ Y DFI RQ + RLGT  EIA  V+ LA D   + TG D+ IDGG SI
Sbjct:   12 MGRLDGKVFVLSAAGQGIGKAVALMAAKEGAKVIATDVNGELLKQLEGVPGIQTQVLDVLNKQEIEKFANSL-DSVDVLFNCAGFVHHGTLLDCAEKDWDFSFNLNVKSVYTMCSYFVPKLIAQGRGGSIINMASVVSSIKGAPNRFVYGATKAAVIGLNKSLAVDFVQHKIRFNTICPGTVDTPSLRDRMAAQGDPEQAYKDFIARQKLGRLGTPDEIAYLVVYLASDESNFVTGQDFIIDGGWSI 257          
BLAST of EMLSAG00000009319 vs. nr
Match: gi|871213919|ref|XP_012934554.1| (PREDICTED: 3-hydroxybutyrate dehydrogenase type 2-like [Aplysia californica])

HSP 1 Score: 297.745 bits (761), Expect = 1.888e-98
Identity = 145/247 (58.70%), Postives = 172/247 (69.64%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRLDGKV +++AAAQGIG+  AL+ AKEGA+V ATD+N  +LKEL    GI    LDV  K+DV     S+ + ID+LFNCAG+VHHG++LDCDE SW  SF +NV S Y MC   VP  I    GGSIINMSS+ SSIKG PNRF Y  TKAAVIG +KSLA D V H IRVN +CPGTVDTPSLRGR+    +PEK   DFI RQ M RL    EIAS V+ LA D   + TG ++ +DGG S+
Sbjct:   41 MGRLDGKVFVLSAAAQGIGKAVALMAAKEGARVIATDVNGEVLKELEGTPGIETQVLDVLKKDDVEKFAKSV-DKIDVLFNCAGFVHHGTLLDCDEKSWDFSFNLNVKSAYTMCSVFVPKFIAQGTGGSIINMSSVVSSIKGAPNRFVYAATKAAVIGMSKSLAVDFVDHKIRVNSVCPGTVDTPSLRGRMAAQADPEKALQDFIARQKMGRLANPEEIASLVVYLASDESGFVTGQEFVVDGGWSM 286          
BLAST of EMLSAG00000009319 vs. nr
Match: gi|1021272319|ref|WP_063298750.1| (NAD(P)-dependent oxidoreductase [Pseudovibrio sp. Ad37] >gi|1020198225|gb|KZL13039.1| 2-keto-3-deoxy-L-fuconate dehydrogenase [Pseudovibrio sp. Ad37] >gi|1099435781|emb|SFL11587.1| 2-keto-3-deoxy-L-fuconate dehydrogenase [Pseudovibrio ascidiaceicola])

HSP 1 Score: 293.893 bits (751), Expect = 1.392e-97
Identity = 143/247 (57.89%), Postives = 180/247 (72.87%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRL GK ALITAA QGIGR T   +A EGAKV+ATDINEA L ELS  EG++  KLDVTN ++V +   ++   +DILFNCAG+VH G+ILDCDED+W  SF +NV +MY +C+A +P+M+EN  GGSIINMSS+ SS+KG+PNRF Y ++KAAVIG TK++A D V   IR N ICPGTVD+PSL  R+  T N E+   DFI RQPM R+G   EIA+  + L  D+ A+ TG  + IDGG S+
Sbjct:    1 MGRLTGKTALITAAGQGIGRSTVEAYAAEGAKVFATDINEAALAELSAIEGVTGLKLDVTNADEVQDTLKTVGP-LDILFNCAGFVHSGTILDCDEDAWDFSFNLNVKAMYRLCRAAIPAMLENG-GGSIINMSSVASSLKGVPNRFVYCSSKAAVIGLTKAIAADFVTKGIRCNAICPGTVDSPSLHDRLKATGNYEQAMKDFIARQPMGRIGKPEEIAALAVYLGSDDSAFTTGQTHAIDGGWSV 245          
BLAST of EMLSAG00000009319 vs. nr
Match: gi|1021263787|ref|WP_063290508.1| (MULTISPECIES: NAD(P)-dependent oxidoreductase [Pseudovibrio] >gi|1020184777|gb|KZK99833.1| 2-keto-3-deoxy-L-fuconate dehydrogenase [Pseudovibrio sp. W74] >gi|1020188967|gb|KZL03960.1| 2-keto-3-deoxy-L-fuconate dehydrogenase [Pseudovibrio sp. Ad14])

HSP 1 Score: 293.893 bits (751), Expect = 1.604e-97
Identity = 142/247 (57.49%), Postives = 181/247 (73.28%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRL GK ALITAA QGIGR T   +A EGAKV+ATDINEA L EL+  EG++  +LDVTN +DV +  + +T  +DILFNCAG+VH+G+ILDCDED+W  SF +NV +MY +C+A +P M+EN  GGSIINMSS+ SS+KG+PNRF Y ++KAAVIG TK++A D V   +R N ICPGTVD+PSL  R+  T N E+   DFI RQPM R+G   EIA+  + L  D+ A+ TG  + IDGG S+
Sbjct:    1 MGRLTGKTALITAAGQGIGRSTVEAYAAEGAKVFATDINEAALTELNAIEGVTGLRLDVTNADDVRDTLE-VTGPLDILFNCAGFVHNGTILDCDEDAWDFSFNLNVKAMYRLCRAAIPGMLENS-GGSIINMSSVASSLKGVPNRFVYCSSKAAVIGLTKAIAADFVTKGVRCNAICPGTVDSPSLHDRLKATGNYEQAMKDFIARQPMGRIGKPEEIAALAVYLGSDDSAFTTGQTHAIDGGWSV 245          
BLAST of EMLSAG00000009319 vs. nr
Match: gi|1021288413|ref|WP_063313116.1| (NAD(P)-dependent oxidoreductase [Pseudovibrio sp. Ad26] >gi|1020181703|gb|KZK96803.1| 2-keto-3-deoxy-L-fuconate dehydrogenase [Pseudovibrio sp. Ad26])

HSP 1 Score: 293.508 bits (750), Expect = 2.041e-97
Identity = 143/247 (57.89%), Postives = 180/247 (72.87%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRL GK ALITAA QGIGR T   +A EGAKV+ATDINEA L ELS  EG++  KLDVTN ++V +   ++   +DILFNCAG+VH G+ILDCDED+W  SF +NV +MY +C+A +P+M+EN  GGSIINMSS+ SS+KG+PNRF Y ++KAAVIG TK++A D V   IR N ICPGTVD+PSL  R+  T N E+   DFI RQPM R+G   EIA+  + L  D+ A+ TG  + IDGG S+
Sbjct:    1 MGRLTGKTALITAAGQGIGRSTVEAYAAEGAKVFATDINEAALDELSAIEGVTGLKLDVTNADEVQDTLKTVGP-LDILFNCAGFVHSGTILDCDEDAWDFSFNLNVKAMYRLCRAAIPAMLENG-GGSIINMSSVASSLKGVPNRFVYCSSKAAVIGLTKAIAADFVTKGIRCNAICPGTVDSPSLHDRLKATGNYEQAMKDFIARQPMGRIGKPEEIAALAVYLGSDDSAFTTGQTHAIDGGWSV 245          
BLAST of EMLSAG00000009319 vs. nr
Match: gi|1021264785|ref|WP_063291448.1| (MULTISPECIES: NAD(P)-dependent oxidoreductase [Pseudovibrio] >gi|1020160336|gb|KZK75684.1| 2-keto-3-deoxy-L-fuconate dehydrogenase [Pseudovibrio sp. Ad46] >gi|1020184553|gb|KZK99611.1| 2-keto-3-deoxy-L-fuconate dehydrogenase [Pseudovibrio sp. Ad5])

HSP 1 Score: 293.508 bits (750), Expect = 2.404e-97
Identity = 142/247 (57.49%), Postives = 181/247 (73.28%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRL GK ALITAA QGIGR T   +A EGAKV+ATDINEA L EL+  EG++  +LDVTN +DV +  + +T  +DILFNCAG+VH+G+ILDCDED+W  SF +NV +MY +C+A +P M+EN  GGSIINMSS+ SS+KG+PNRF Y ++KAAVIG TK++A D V   +R N ICPGTVD+PSL  R+  T N E+   DFI RQPM R+G   EIA+  + L  D+ A+ TG  + IDGG S+
Sbjct:    1 MGRLTGKTALITAAGQGIGRSTVEAYAAEGAKVFATDINEAALTELNAIEGVTGLRLDVTNADDVRDTLE-VTGPLDILFNCAGFVHNGTILDCDEDAWDFSFNLNVKAMYRLCRAAIPGMLENG-GGSIINMSSVASSLKGVPNRFVYCSSKAAVIGLTKAIAADFVTKGVRCNAICPGTVDSPSLHDRLKATGNYEQAMKDFIARQPMGRIGKPEEIAALAVYLGSDDSAFTTGQTHAIDGGWSV 245          
BLAST of EMLSAG00000009319 vs. nr
Match: gi|1021278691|ref|WP_063304465.1| (NAD(P)-dependent oxidoreductase [Pseudovibrio sp. W64] >gi|1020162712|gb|KZK78035.1| 2-keto-3-deoxy-L-fuconate dehydrogenase [Pseudovibrio sp. W64])

HSP 1 Score: 293.123 bits (749), Expect = 2.833e-97
Identity = 142/247 (57.49%), Postives = 181/247 (73.28%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            MGRL GK ALITAA QGIGR T   +A EGAKV+ATDINEA L EL+  EG++  +LDVTN +DV +  + +T  +DILFNCAG+VH+G+ILDCDED+W  SF +NV +MY +C+A +P M+E K GGSIINMSS+ SS+KG+PNRF Y ++KAAVIG TK++A D V   +R N ICPGTVD+PSL  R+  T N E+   DFI RQPM R+G   EIA+  + L  D+ A+ TG  + IDGG S+
Sbjct:    1 MGRLTGKTALITAAGQGIGRSTVEAYAAEGAKVFATDINEAALTELNAIEGVTGLRLDVTNADDVRDTLE-VTGPLDILFNCAGFVHNGTILDCDEDAWDFSFNLNVKAMYRLCRAAIPGMLE-KGGGSIINMSSVASSLKGVPNRFVYCSSKAAVIGLTKAVAADFVTKGVRCNAICPGTVDSPSLHDRLKATGNYEQAMKDFIARQPMGRIGKPEEIAALAVYLGSDDSAFTTGQTHAIDGGWSV 245          
BLAST of EMLSAG00000009319 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold751_size102555-snap-gene-0.9 (protein:Tk01470 transcript:maker-scaffold751_size102555-snap-gene-0.9-mRNA-1 annotation:"3-hydroxybutyrate dehydrogenase type 2")

HSP 1 Score: 261.151 bits (666), Expect = 2.011e-88
Identity = 137/245 (55.92%), Postives = 175/245 (71.43%), Query Frame = 0
Query:    3 RLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            RL+GKVA+++AAAQGIGR TA+ +A+EG +VYA D+N   LKEL + +GI   K+DV NK D+    D I + IDILFNC GYVH G+ILDC ED  ++SF+INV  M+ MC+A +P M++ K+G S++NMSS+ SSI G   RFAYG TKAAVIG TKSLA D V + IRVN +CPGTV+TPS   RVN   +P +   DF+ RQ M RLGT+ EIA  V  L  D  AY TG ++ IDGG+S+
Sbjct:    5 RLEGKVAVVSAAAQGIGRATAIKWAQEGCQVYAVDLNGDKLKELEHVDGIVTRKVDVLNKSDIAALADEI-DVIDILFNCVGYVHQGTILDCTEDILEKSFDINVKGMFLMCQAFLPKMMKQKRG-SVVNMSSVVSSIMGAKARFAYGVTKAAVIGLTKSLAVDYVAYGIRVNSVCPGTVETPSWHDRVNEHEDPAQAKKDFVQRQKMGRLGTAEEIAHIVTYLGSDESAYATGQEFVIDGGMSL 247          
BLAST of EMLSAG00000009319 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold83_size396513-snap-gene-1.17 (protein:Tk00960 transcript:maker-scaffold83_size396513-snap-gene-1.17-mRNA-1 annotation:"hypothetical protein LOTGIDRAFT_236007")

HSP 1 Score: 120.939 bits (302), Expect = 4.019e-33
Identity = 79/256 (30.86%), Postives = 135/256 (52.73%), Query Frame = 0
Query:    4 LDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGIS-------IFKLDV---TNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPG-TVDTPSLRGRVNNTPNPEKTYTDFINR----QPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            L G+VA+IT A+ GIG  TA+LF++ GA V  T  N A L++ ++   ++       + + D+   T+ + +M+        +DIL N AG +  G I +   + + R   +NV +MY++     P +++ +  G+I+N+SS+ + ++  P   AY  +KAAV  FT+ +A DL    +RVNC+ PG T+     RG ++     ++ Y  F+ R      M R G   E+A  +  LA  + ++ TG    +DGG
Sbjct:    6 LAGQVAIITGASSGIGAATAVLFSQLGATVALTGRNVANLEKTASRMEVNGEQKKPLLIQADLGLETDTQKIMDETIKAFGRLDILVNNAGVIELGGIENTSLEQYDRIMNVNVRAMYHLTMLATPHLVKTR--GNIVNVSSV-NGMRSFPGVLAYNISKAAVDQFTRCVALDLAPKQVRVNCVNPGVTITELQKRGGLS-----DEAYAKFLERSKETHAMGRAGLPEEVAQAIAFLASPSASFSTGISLPVDGG 253          
BLAST of EMLSAG00000009319 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1182_size56756-snap-gene-0.8 (protein:Tk09769 transcript:maker-scaffold1182_size56756-snap-gene-0.8-mRNA-1 annotation:"dehydrogenase reductase sdr family member 4")

HSP 1 Score: 120.168 bits (300), Expect = 6.403e-33
Identity = 78/251 (31.08%), Postives = 131/251 (52.19%), Query Frame = 0
Query:    3 RLDGKVALITAAAQGIGRETALLFAKEGAKVY-----ATDINEAL--LKELS-NHEGISIFKLDVTNKEDVMNAKDSITESIDILF-NCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            R  GKVA++TA+  GIG   A   A++G KV      A +++ AL  LK L+ +  G++       ++E+++        +ID L  N A    +GSILD  ++ W + F++NV S + + K I+P + +   GGSI+ +SSI   +  +P   AY  +K A++G TK+L+ +     +RVNCI PG + T   +    +    E      +N   ++R GT  +IA     L  D+ +Y +G ++ + GG
Sbjct:   36 RFGGKVAIVTASTDGIGLGIAKRLAEDGCKVMISSRKAANVSRALDELKALNLDVAGVTCHVAKAEDRENLVQETIQKFGTIDFLVSNAAVNPTYGSILDVTDEQWSKIFDVNVKSSFLLAKRIIPEITKQSTGGSIVFISSI-GGLHPMPMIGAYSVSKTALLGLTKALSFECAPQGVRVNCIAPGVIRTKFAQAMTES----EDISEIILNSLHIKRFGTPEDIAGMAAFLCSDDASYISGENFVVAGG 281          
BLAST of EMLSAG00000009319 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold4015_size6909-snap-gene-0.6 (protein:Tk04137 transcript:maker-scaffold4015_size6909-snap-gene-0.6-mRNA-1 annotation:"GH12482")

HSP 1 Score: 111.694 bits (278), Expect = 5.721e-30
Identity = 80/251 (31.87%), Postives = 120/251 (47.81%), Query Frame = 0
Query:    4 LDGKVALITAAAQGIGRETALLFAKEGAKVYATDIN----EALLKELSNHEGISIFKLDVTNKEDVMNAKDSIT----ESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENK-KGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGL 245
            L G++A +T   +GIGR    + A+EGA+V A D++    +  LK LS        + DV + + V NA   +     E   I+ N AG    G +L   E ++ +   +N+   + + +    +M   + K  SIIN++SI   + G   +  Y  +KA VIGFTK+ A +L K  IRVNCI PG + TP      +  P+  K    F  + PM   G   +IA     LA D   Y  G    ++GGL
Sbjct:   15 LSGRLAFVTGGGRGIGRAVCQILAREGARVVAADLDVDAAQESLKGLSGDH--MTLEADVASLDSVQNASAEVLAQFGEHPSIVVNSAGITRDGYLLKMSEQNFDQVINVNLKGTFNVNQTFAAAMKSGQVKPASIINVASISGQV-GNAGQTNYSASKAGVIGFTKAAAKELGKFGIRVNCIAPGFIQTP----MTDTIPDHLKQMLLF--QIPMGDFGLPQDIAETAAFLASDRSRYVHGAIINVNGGL 256          
BLAST of EMLSAG00000009319 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold76_size406464-snap-gene-2.15 (protein:Tk10239 transcript:maker-scaffold76_size406464-snap-gene-2.15-mRNA-1 annotation:"3-oxoacyl-acyl-carrier-protein reductase")

HSP 1 Score: 107.457 bits (267), Expect = 7.429e-27
Identity = 76/256 (29.69%), Postives = 122/256 (47.66%), Query Frame = 0
Query:    1 MGRLDGKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNH------EGISIFKLDVTNKEDVMNAKDSITES---IDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            M    GK+ LIT A+ GIG  TA  FA  GAK+     NEA L+E++        E + +   D+   E  + A +S       +D+L N AG +H  ++ +  ++ ++ +  +NV S   M +  V  + E     +++N+SSI + ++  P   AY  +KAA+   T+  A +L    IRVN + PG ++T        N    +  Y       P+ R G   E+AS +  LA D   + TG    +DGG S+
Sbjct:  205 MSCFKGKIILITGASSGIGAGTAKHFAALGAKLALVARNEAKLQEIATECRKAGAEDVFVSSHDLGLSEGCVQAIESTVSHFGGLDVLVNNAGIMHTQNLENTTDEHFEEAMRVNVRSAMKMTQLAVKHL-EGSSLKNVVNISSI-AGLRAYPGALAYKMSKAAMDQLTRCSALELAPKGIRVNSVNPGVIETDIFEKAGMNAKGVKSFYERAKKTHPLGRAGKVEEVASVIAFLASDGATFVTGQTVAVDGGRSV 458          

HSP 2 Score: 86.2705 bits (212), Expect = 1.511e-19
Identity = 50/177 (28.25%), Postives = 91/177 (51.41%), Query Frame = 0
Query:   75 SIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINR----QPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGGLSI 247
            S+D+L N AG +  GS      + + R   IN  + + + +A +P +++ K  G+++++SS+ + ++  P   AY  +KAAV    ++ A ++  H +RVN + PG + T   +         ++ Y  F+        M R+GT  E+A  V  LA ++ ++ TG    IDGG S+
Sbjct:  462 SLDVLVNSAGILVSGSTESLSWEDYDRCMNINTKAAFILSQAAIPHLLKTK--GNMVHISSV-TGLRAFPGVVAYNMSKAAVDQLVRTCALEMAPHGVRVNAVNPGVIVTEVHK----RAGMKDEAYEAFLEHSKTTHAMGRVGTVDEVAKTVAFLASEDASFITGQTLAIDGGRSV 631          
BLAST of EMLSAG00000009319 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1414_size42706-snap-gene-0.11 (protein:Tk10775 transcript:maker-scaffold1414_size42706-snap-gene-0.11-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_305430")

HSP 1 Score: 92.0485 bits (227), Expect = 9.467e-23
Identity = 69/240 (28.75%), Postives = 111/240 (46.25%), Query Frame = 0
Query:    6 GKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNH-EGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            GK  LIT   QGIGR TA+     GA+V+   + +  L  L      I  +  D++  +++    +S+   +D + N A       IL+  E    +    NV ++  + + +   MIE ++ G+ +N+SS  +S+  L +  AY  +KAAV   T+ +A +  KHNIR NC+ P    T   + + N+    E          P+QR     EIA  ++ L  D  +   G    IDGG
Sbjct:    7 GKRILITGVGQGIGRCTAVSLHAMGAEVHGISLTQKNLDSLREECPNIKTYCQDISQWDNLKRLLESLP-VMDGVVNNAAINILEPILEVQESHLDKVLNTNVKAVLNISQTMGRKMIEAQRSGAFVNVSS-QASLVALEDHVAYAASKAAVDQITRLMALEFGKHNIRSNCVNPTVALTELGKLKWNDPAVAEPMKKKI----PLQRFAEPQEIADVIIFLLSDKASMVNGIIMPIDGG 240          
BLAST of EMLSAG00000009319 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold503_size153465-snap-gene-0.15 (protein:Tk08622 transcript:maker-scaffold503_size153465-snap-gene-0.15-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_305430")

HSP 1 Score: 92.0485 bits (227), Expect = 9.467e-23
Identity = 69/240 (28.75%), Postives = 111/240 (46.25%), Query Frame = 0
Query:    6 GKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNH-EGISIFKLDVTNKEDVMNAKDSITESIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            GK  LIT   QGIGR TA+     GA+V+   + +  L  L      I  +  D++  +++    +S+   +D + N A       IL+  E    +    NV ++  + + +   MIE ++ G+ +N+SS  +S+  L +  AY  +KAAV   T+ +A +  KHNIR NC+ P    T   + + N+    E          P+QR     EIA  ++ L  D  +   G    IDGG
Sbjct:    7 GKRILITGVGQGIGRCTAVSLHAMGAEVHGISLTQKNLDSLREECPNIKTYCQDISQWDNLKRLLESLP-VMDGVVNNAAINILEPILEVQESHLDKVLNTNVKAVLNISQTMGRKMIEAQRSGAFVNVSS-QASLVALEDHVAYAASKAAVDQITRLMALEFGKHNIRSNCVNPTVALTELGKLKWNDPAVAEPMKKKI----PLQRFAEPQEIADVIIFLLSDKASMVNGIIMPIDGG 240          
BLAST of EMLSAG00000009319 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold470_size172058-snap-gene-0.37 (protein:Tk09903 transcript:maker-scaffold470_size172058-snap-gene-0.37-mRNA-1 annotation:"GJ15354")

HSP 1 Score: 91.6633 bits (226), Expect = 1.619e-22
Identity = 81/254 (31.89%), Postives = 125/254 (49.21%), Query Frame = 0
Query:    4 LDGKVALITAAAQGIGRETALLFAKEGAKVYA-----TDINEALLKELSN--HEGISIFKLDVTNKEDVMNAKDSITES---IDILFNCAG-YVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICS--SIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            +D KVA++T A+ GIG   A   A+ G K  A      +  E + KEL     + + + K+D+TN ED     + I      ID+L N AG Y    S+ D   ++ ++  ++N  +     K  +P MIE  KG +I+ +SSI +  S KG  +   YG +K A+  FTK LA +     +RVN + PG +   +L        +PE   T   N QP++  G   ++A+ V  LA D   + TG +  +DGG
Sbjct:    1 MDQKVAVVTGASSGIGVGIARHLAQNGYKNLAILARRQEKLEEVKKELLELGAKAVLVLKVDLTNDEDCALGIEQIKTQFSRIDLLVNNAGAYFGVASVKDKPLENVRKMIDLNFTAQVSWTKLALP-MIEACKG-NIVFISSIAAQCSFKGFSD---YGASKVALDYFTKILAREEASEGVRVNTVSPGAILVNAL-----GFESPEIGQTVLANAQPLKICGQVDDVAAAVGFLASDKAKFITGANLVVDGG 244          
BLAST of EMLSAG00000009319 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1871_size25962-snap-gene-0.0 (protein:Tk08056 transcript:maker-scaffold1871_size25962-snap-gene-0.0-mRNA-1 annotation:"acyl- dehydrogenase domain-containing protein")

HSP 1 Score: 90.8929 bits (224), Expect = 2.798e-21
Identity = 63/181 (34.81%), Postives = 92/181 (50.83%), Query Frame = 0
Query:   56 KLDVTNKEDVMNA-KDSITE--SIDILFNCAGYVHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAY 233
            K+DV + + +  A  D+I     IDIL N AG +   S L   +D W+   +IN+  ++   KA+VP M+E KK G +I  SS+   I G   +  Y   KAA+IG  K+ A +  KHNI  N + PG + T            PE+    FI   P++RLG   +IA+  L LA +  +Y
Sbjct:   17 KVDVKDIKSIEAAVNDTIARFGKIDILVNNAGILRDKSFLKMTQDEWQSVIDINLTGVFNCTKAVVPHMVE-KKYGRVICTSSVV-GITGGFGQTNYVACKAAIIGMVKTWAKEFGKHNITANAVAPGFIKTEM------TDSIPEEIRNGFIADIPVRRLGEPADIANAYLFLATEEASY 189          
BLAST of EMLSAG00000009319 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold6642_size3699-snap-gene-0.4 (protein:Tk06486 transcript:maker-scaffold6642_size3699-snap-gene-0.4-mRNA-1 annotation:"short-chain dehydrogenase reductase family")

HSP 1 Score: 89.7373 bits (221), Expect = 3.696e-21
Identity = 77/251 (30.68%), Postives = 116/251 (46.22%), Query Frame = 0
Query:    6 GKVALITAAAQGIGRETALLFAKEGAKVYATDINEALLKELSNHEGISIF--------KLDVTNKEDVMNAKDSITE---SIDILFNCAGY-VHHGSILDCDEDSWKRSFEINVDSMYYMCKAIVPSMIENKKGGSIINMSSICSSIKGLPNRFAYGTTKAAVIGFTKSLACDLVKHNIRVNCICPGTVDTPSLRGRVNNTPNPEKTYTDFINRQPMQRLGTSTEIASFVLTLAEDNGAYCTGGDYKIDGG 244
            GKVAL+T A++G+G   A   A  GA V  +   +  L   +  EGI+            +V  KE +    D   E    ID +   AG   ++G   +  +D++ ++ + NV S  ++ + + P M+  K GGS+   SSI  + K       YG +K A+IG  ++LA +   + IR N ICPG V T   R   +   NPE       N  P++RLG   + A   + LA D   Y TG    + GG
Sbjct:  119 GKVALLTGASKGMGLAMATALATHGATVVISARKQDQLDAAA--EGINALGKGRAHAVACNVGYKEQLQALVDKTHELAGPIDCVIGNAGVNPYYGKTSEIPDDAYTKTMDANVRSNLWLAQMVAPDMVA-KGGGSMAFTSSI-GAFKPSVMLGTYGMSKLALIGLVRNLAAEFGPNGIRFNAICPGLVKTEFARELWD---NPE-VAKRIENEIPLRRLGDPEDFAGLAVFLASDASKYMTGQALTVCGG 361          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000009319 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-4.386e-9456.28symbol:LOC100522692 "Uncharacterized protein" spec... [more]
-6.422e-9356.28symbol:BDH2 "3-hydroxybutyrate dehydrogenase type ... [more]
-7.894e-9356.28symbol:BDH2 "3-hydroxybutyrate dehydrogenase type ... [more]
-2.784e-9254.66symbol:BDH2 "Uncharacterized protein" species:9031... [more]
-3.171e-9255.06symbol:bdh2 "3-hydroxybutyrate dehydrogenase type ... [more]
-1.360e-9055.06symbol:Bdh2 "3-hydroxybutyrate dehydrogenase, type... [more]
-2.169e-9054.66symbol:Bdh2 "3-hydroxybutyrate dehydrogenase, type... [more]
-7.726e-9054.66symbol:bdh2 "3-hydroxybutyrate dehydrogenase type ... [more]
-1.444e-8654.03symbol:bdh2 "3-hydroxybutyrate dehydrogenase, type... [more]
-1.528e-8354.66symbol:BDH2 "3-hydroxybutyrate dehydrogenase type ... [more]

Pages

back to top
BLAST of EMLSAG00000009319 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592770974|gb|GAXK01183594.1|9.283e-8656.35TSA: Calanus finmarchicus comp57085_c1_seq1 transc... [more]
gi|592909287|gb|GAXK01049088.1|2.767e-2631.62TSA: Calanus finmarchicus comp64383_c0_seq1 transc... [more]
gi|592911710|gb|GAXK01046665.1|2.280e-2329.62TSA: Calanus finmarchicus comp138768_c0_seq1 trans... [more]
gi|592821194|gb|GAXK01133374.1|5.549e-2328.74TSA: Calanus finmarchicus comp1332819_c0_seq1 tran... [more]
gi|592924811|gb|GAXK01033604.1|8.955e-2331.78TSA: Calanus finmarchicus comp83857_c1_seq2 transc... [more]
gi|592762762|gb|GAXK01191651.1|1.355e-2229.88TSA: Calanus finmarchicus comp40688_c3_seq3 transc... [more]
gi|592924812|gb|GAXK01033603.1|2.557e-2231.78TSA: Calanus finmarchicus comp83857_c1_seq1 transc... [more]
gi|592817815|gb|GAXK01136753.1|4.181e-2027.56TSA: Calanus finmarchicus comp716955_c0_seq1 trans... [more]
gi|592762764|gb|GAXK01191649.1|1.196e-1828.97TSA: Calanus finmarchicus comp40688_c3_seq1 transc... [more]
gi|592762761|gb|GAXK01191652.1|6.092e-1826.64TSA: Calanus finmarchicus comp40688_c3_seq4 transc... [more]

Pages

back to top
BLAST of EMLSAG00000009319 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 15
Match NameE-valueIdentityDescription
EMLSAP000000093190.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s595:50362... [more]
EMLSAP000000101121.789e-3335.25pep:novel supercontig:LSalAtl2s:LSalAtl2s668:19005... [more]
EMLSAP000000023473.607e-2129.28pep:novel supercontig:LSalAtl2s:LSalAtl2s1446:5399... [more]
EMLSAP000000101072.820e-1730.29pep:novel supercontig:LSalAtl2s:LSalAtl2s667:33408... [more]
EMLSAP000000126254.498e-1726.43pep:novel supercontig:LSalAtl2s:LSalAtl2s94:78040:... [more]
EMLSAP000000094781.054e-1631.10pep:novel supercontig:LSalAtl2s:LSalAtl2s611:10693... [more]
EMLSAP000000088131.796e-1426.80pep:novel supercontig:LSalAtl2s:LSalAtl2s549:45353... [more]
EMLSAP000000093467.408e-1430.77pep:novel supercontig:LSalAtl2s:LSalAtl2s598:26250... [more]
EMLSAP000000102163.852e-1127.32pep:novel supercontig:LSalAtl2s:LSalAtl2s679:14494... [more]
EMLSAP000000102134.084e-1126.09pep:novel supercontig:LSalAtl2s:LSalAtl2s679:13973... [more]

Pages

back to top
BLAST of EMLSAG00000009319 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|110808203|sp|Q3T046.1|BDH2_BOVIN1.548e-9456.28RecName: Full=3-hydroxybutyrate dehydrogenase type... [more]
gi|123913584|sp|Q3KPT7.1|BDH2_XENLA6.267e-9455.06RecName: Full=3-hydroxybutyrate dehydrogenase type... [more]
gi|306531055|sp|D4A1J4.2|BDH2_RAT2.747e-9255.06RecName: Full=3-hydroxybutyrate dehydrogenase type... [more]
gi|77416417|sp|Q8JZV9.1|BDH2_MOUSE4.394e-9254.66RecName: Full=3-hydroxybutyrate dehydrogenase type... [more]
gi|306531048|sp|C1C4R8.1|BDH2_LITCT1.577e-9154.66RecName: Full=3-hydroxybutyrate dehydrogenase type... [more]
gi|82193321|sp|Q561X9.1|BDH2_DANRE3.087e-8854.03RecName: Full=3-hydroxybutyrate dehydrogenase type... [more]
gi|125987797|sp|Q9BUT1.2|BDH2_HUMAN3.415e-8554.66RecName: Full=3-hydroxybutyrate dehydrogenase type... [more]
gi|81792293|sp|Q8P3K4.1|FUCDH_XANCP1.376e-8154.07RecName: Full=2-keto-3-deoxy-L-fuconate dehydrogen... [more]
gi|6919838|sp|Q9X248.1|FABG_THEMA2.044e-4837.55RecName: Full=3-oxoacyl-[acyl-carrier-protein] red... [more]
gi|6831715|sp|Q9WYG0.1|Y325_THEMA2.623e-4838.46RecName: Full=Uncharacterized oxidoreductase TM_03... [more]

Pages

back to top
BLAST of EMLSAG00000009319 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
gb|KFM72093.1|8.387e-4037.30Estradiol 17-beta-dehydrogenase 8, partial [Stegod... [more]
AGB95045.11.592e-3733.07CG3603, isoform B [Drosophila melanogaster][more]
AAF45844.21.592e-3733.07CG3603, isoform A [Drosophila melanogaster][more]
EAA07681.69.000e-3433.07AGAP002520-PA [Anopheles gambiae str. PEST][more]
gb|KFM80662.1|1.283e-3333.47Dehydrogenase/reductase SDR family member 4, parti... [more]
gb|EFA08221.1|3.763e-3334.58L-xylulose reductase-like Protein [Tribolium casta... [more]
XP_006558481.14.269e-3330.80PREDICTED: estradiol 17-beta-dehydrogenase 8 [Apis... [more]
XP_006562411.17.646e-3333.47PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reduct... [more]
EGK96869.18.749e-3334.39AGAP002521-PB [Anopheles gambiae str. PEST][more]
EAA07469.48.749e-3334.39AGAP002521-PA [Anopheles gambiae str. PEST][more]

Pages

back to top
BLAST of EMLSAG00000009319 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|225709498|gb|ACO10595.1|3.591e-14178.233-hydroxybutyrate dehydrogenase type 2 [Caligus ro... [more]
gi|225718134|gb|ACO14913.1|7.054e-13173.283-hydroxybutyrate dehydrogenase type 2 [Caligus cl... [more]
gi|908484099|ref|XP_013092993.1|8.389e-9958.30PREDICTED: 3-hydroxybutyrate dehydrogenase type 2-... [more]
gi|908484096|ref|XP_013092992.1|1.549e-9858.30PREDICTED: 3-hydroxybutyrate dehydrogenase type 2-... [more]
gi|871213919|ref|XP_012934554.1|1.888e-9858.70PREDICTED: 3-hydroxybutyrate dehydrogenase type 2-... [more]
gi|1021272319|ref|WP_063298750.1|1.392e-9757.89NAD(P)-dependent oxidoreductase [Pseudovibrio sp. ... [more]
gi|1021263787|ref|WP_063290508.1|1.604e-9757.49MULTISPECIES: NAD(P)-dependent oxidoreductase [Pse... [more]
gi|1021288413|ref|WP_063313116.1|2.041e-9757.89NAD(P)-dependent oxidoreductase [Pseudovibrio sp. ... [more]
gi|1021264785|ref|WP_063291448.1|2.404e-9757.49MULTISPECIES: NAD(P)-dependent oxidoreductase [Pse... [more]
gi|1021278691|ref|WP_063304465.1|2.833e-9757.49NAD(P)-dependent oxidoreductase [Pseudovibrio sp. ... [more]

Pages

back to top
BLAST of EMLSAG00000009319 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 25
Match NameE-valueIdentityDescription
maker-scaffold751_size102555-snap-gene-0.92.011e-8855.92protein:Tk01470 transcript:maker-scaffold751_size1... [more]
maker-scaffold83_size396513-snap-gene-1.174.019e-3330.86protein:Tk00960 transcript:maker-scaffold83_size39... [more]
maker-scaffold1182_size56756-snap-gene-0.86.403e-3331.08protein:Tk09769 transcript:maker-scaffold1182_size... [more]
maker-scaffold4015_size6909-snap-gene-0.65.721e-3031.87protein:Tk04137 transcript:maker-scaffold4015_size... [more]
maker-scaffold76_size406464-snap-gene-2.157.429e-2729.69protein:Tk10239 transcript:maker-scaffold76_size40... [more]
maker-scaffold1414_size42706-snap-gene-0.119.467e-2328.75protein:Tk10775 transcript:maker-scaffold1414_size... [more]
maker-scaffold503_size153465-snap-gene-0.159.467e-2328.75protein:Tk08622 transcript:maker-scaffold503_size1... [more]
maker-scaffold470_size172058-snap-gene-0.371.619e-2231.89protein:Tk09903 transcript:maker-scaffold470_size1... [more]
maker-scaffold1871_size25962-snap-gene-0.02.798e-2134.81protein:Tk08056 transcript:maker-scaffold1871_size... [more]
maker-scaffold6642_size3699-snap-gene-0.43.696e-2130.68protein:Tk06486 transcript:maker-scaffold6642_size... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s595supercontigLSalAtl2s595:50362..51363 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s595-augustus-gene-0.32
Biotypeprotein_coding
EvidenceIEA
Note3-hydroxybutyrate dehydrogenase type 2
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000009319 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000009319EMLSAT00000009319-705166Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s595:50362..51363-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000009319-692085 ID=EMLSAG00000009319-692085|Name=EMLSAG00000009319|organism=Lepeophtheirus salmonis|type=gene|length=1002bp|location=Sequence derived from alignment at LSalAtl2s595:50362..51363- (Lepeophtheirus salmonis)
TTTCTTTCAAAAATGGGTCGATTAGATGGTAAAGTAGCACTCATCACTGC TGCGGCTCAAGGAATTGGTCGTGAAACAGCTCTACTCTTTGCAAAGGAAG GAGCGAAGGTCTACGCAACAGATATAAACGAAGCTCTACTCAAGGAGTTG TCTAATCATGAGGGTATATCCATTTTCAAATTAGATGTGACTAATAAGGA AGATGTAATGAATGCCAAGGACTCCATTACTGAGAGCATTGATATACTCT TTAACTGTGCTGGGTAAAAGTCAGGATTTTAATCCCTTGTGGGTCCTATG TTCAAATAATAACTTATTCCATGCTACTAGATACGTGCACCATGGAAGTA TATTGGACTGTGATGAAGACTCATGGAAGCGTAGCTTTGAAATAAATGTA GATAGCATGTATTACATGTGTAAAGCCATTGTTCCCTCCGTAATGTATCA TCATAGTTATAACTCGTAACATTTTTAATTCTAATCCATGTTTGATTTAT AGATGATTGAGAATAAGAAGGGTGGAAGTATAATAAATATGTCCTCCATT TGCTCATCCATCAAAGGTCTCCCAAATCGTTTTGCATATGGAACAACCAA AGCTGCAGTAATTGGATTTACTAAATCCCTAGCATGTGATCTTGTTAAGC ACAACATCAGAGTCAACTGCATTTGTCCAGGAACAGTGGATACACCGTCA TTGAGGTATTTGAAAAAGTATTAAAAGATTTACCAATAATTCAAACGTTT TGACTTCATCAGAGGCCGAGTTAATAATACTCCTAACCCAGAGAAAACAT ACACGGATTTTATCAATCGCCAGCCCATGCAACGACTAGGAACTTCCACA GAAATTGCCAGTTTCGTCCTTACTCTGGCAGAAGACAATGTATTTATGAA AGACAAGTTTATTAGTACATTTATTTATGTATATTATAATTTCTTTAGGG AGCGTATTGTACTGGAGGAGACTATAAAATTGATGGAGGCCTCAGCATTT AA
back to top
Add to Basket