EMLSAG00000012818, EMLSAG00000012818-695584 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000012818 vs. C. finmarchicus
Match: gi|592901358|gb|GAXK01057017.1| (TSA: Calanus finmarchicus comp2915453_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 2.187e+0 Identity = 13/38 (34.21%), Postives = 22/38 (57.89%), Query Frame = 0 Query: 6 IETSKIMPNKCCVPKCSSGYDGKPAIARLSLHSFPLDE 43 + I+ + CVP+ SS + A+++L+LHS L E Sbjct: 193 FHSPHILVSWSCVPQFSSSFPQHKALSKLTLHS*SLVE 306
BLAST of EMLSAG00000012818 vs. C. finmarchicus
Match: gi|592940640|gb|GAXK01017913.1| (TSA: Calanus finmarchicus comp33655_c4_seq1 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 3.717e+0 Identity = 14/30 (46.67%), Postives = 15/30 (50.00%), Query Frame = 0 Query: 14 NKCCVPKCSSGYDGKPAIARLSLHSFPLDE 43 N+CC P DG AR SLH F L E Sbjct: 1627 NQCCFPVPRPAVDGVLLCARHSLHLFQLAE 1716
BLAST of EMLSAG00000012818 vs. L. salmonis peptides
Match: EMLSAP00000012818 (pep:novel supercontig:LSalAtl2s:LSalAtl2s977:162868:163832:-1 gene:EMLSAG00000012818 transcript:EMLSAT00000012818 description:"snap-LSalAtl2s977-processed-gene-1.30") HSP 1 Score: 126.331 bits (316), Expect = 1.369e-39 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0 Query: 1 MRSRYIETSKIMPNKCCVPKCSSGYDGKPAIARLSLHSFPLDESSKGVWLRAIPRDSNGT 60 MRSRYIETSKIMPNKCCVPKCSSGYDGKPAIARLSLHSFPLDESSKGVWLRAIPRDSNGT Sbjct: 1 MRSRYIETSKIMPNKCCVPKCSSGYDGKPAIARLSLHSFPLDESSKGVWLRAIPRDSNGT 60
BLAST of EMLSAG00000012818 vs. L. salmonis peptides
Match: EMLSAP00000002611 (pep:novel supercontig:LSalAtl2s:LSalAtl2s151:424347:426407:1 gene:EMLSAG00000002611 transcript:EMLSAT00000002611 description:"augustus-LSalAtl2s151-processed-gene-4.1") HSP 1 Score: 104.76 bits (260), Expect = 1.670e-28 Identity = 46/51 (90.20%), Postives = 50/51 (98.04%), Query Frame = 0 Query: 10 KIMPNKCCVPKCSSGYDGKPAIARLSLHSFPLDESSKGVWLRAIPRDSNGT 60 +IMPNKCCVPKC+SGYDGKP+IARLSLHSFPLD+SSKG WLRAIPRDSNGT Sbjct: 136 EIMPNKCCVPKCTSGYDGKPSIARLSLHSFPLDKSSKGAWLRAIPRDSNGT 186
BLAST of EMLSAG00000012818 vs. L. salmonis peptides
Match: EMLSAP00000003645 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1996:11452:13551:-1 gene:EMLSAG00000003645 transcript:EMLSAT00000003645 description:"snap-LSalAtl2s1996-processed-gene-0.9") HSP 1 Score: 76.6406 bits (187), Expect = 1.951e-19 Identity = 35/39 (89.74%), Postives = 36/39 (92.31%), Query Frame = 0 Query: 9 SKIMPNKCCVPKCSSGYDGKPAIARLSLHSFPLDESSKG 47 + IMPNKCCVPKCSSGYDGK AIAR SLHSFPLDESSKG Sbjct: 96 TMIMPNKCCVPKCSSGYDGKTAIARSSLHSFPLDESSKG 134
BLAST of EMLSAG00000012818 vs. L. salmonis peptides
Match: EMLSAP00000012721 (pep:novel supercontig:LSalAtl2s:LSalAtl2s965:308987:310501:-1 gene:EMLSAG00000012721 transcript:EMLSAT00000012721 description:"augustus-LSalAtl2s965-processed-gene-3.12") HSP 1 Score: 48.521 bits (114), Expect = 2.790e-8 Identity = 21/48 (43.75%), Postives = 25/48 (52.08%), Query Frame = 0 Query: 12 MPNKCCVPKCSSGYDGKPAIARLSLHSFPLDESSKGVWLRAIPRDSNG 59 MPN CC+P C S Y G ++LH FP D S K WL A+ G Sbjct: 1 MPNNCCIPHCKSRYKGYLKRYGVTLHVFPKDASIKDAWLHAVSSQMKG 48
BLAST of EMLSAG00000012818 vs. L. salmonis peptides
Match: EMLSAP00000000142 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1021:140193:141338:-1 gene:EMLSAG00000000142 transcript:EMLSAT00000000142 description:"snap-LSalAtl2s1021-processed-gene-0.80") HSP 1 Score: 42.743 bits (99), Expect = 3.196e-7 Identity = 19/50 (38.00%), Postives = 30/50 (60.00%), Query Frame = 0 Query: 12 MPNKCCVPKCSSGYDGKPAIARLSLHSFPLDESSKGV---WLRAIPRDSN 58 M K C P C +GYD +P + + +H +P E + G+ WLRAI R+++ Sbjct: 1 MATKFCAPGCGTGYDNEPQQSGVKIHLWPNKERNPGLDTAWLRAITRETD 50
BLAST of EMLSAG00000012818 vs. Select Arthropod Genomes
Match: gb|KFM76217.1| (hypothetical protein X975_14765, partial [Stegodyphus mimosarum]) HSP 1 Score: 47.3654 bits (111), Expect = 1.222e-8 Identity = 24/48 (50.00%), Postives = 27/48 (56.25%), Query Frame = 0 Query: 12 MPNKCCVPKCSSGYDGKPAIARLSLHSFPLDESSKGVWLRAIPRDSNG 59 MPNKC V C S YD + R +L S P DE K WLR IP D +G Sbjct: 1 MPNKCSVAGCRSNYDTEKE--RTTLFSLPKDEEKKKEWLRKIPTDFSG 46
BLAST of EMLSAG00000012818 vs. Select Arthropod Genomes
Match: gb|KFM74565.1| (hypothetical protein X975_11446, partial [Stegodyphus mimosarum]) HSP 1 Score: 47.3654 bits (111), Expect = 1.222e-8 Identity = 24/48 (50.00%), Postives = 27/48 (56.25%), Query Frame = 0 Query: 12 MPNKCCVPKCSSGYDGKPAIARLSLHSFPLDESSKGVWLRAIPRDSNG 59 MPNKC V C S YD + R +L S P DE K WLR IP D +G Sbjct: 1 MPNKCSVAGCRSNYDTEKE--RTTLFSLPKDEEKKKEWLRKIPTDFSG 46
BLAST of EMLSAG00000012818 vs. Select Arthropod Genomes
Match: gb|KFM69111.1| (hypothetical protein X975_07031, partial [Stegodyphus mimosarum]) HSP 1 Score: 47.3654 bits (111), Expect = 1.222e-8 Identity = 24/48 (50.00%), Postives = 27/48 (56.25%), Query Frame = 0 Query: 12 MPNKCCVPKCSSGYDGKPAIARLSLHSFPLDESSKGVWLRAIPRDSNG 59 MPNKC V C S YD + R +L S P DE K WLR IP D +G Sbjct: 1 MPNKCSVAGCRSNYDTEKE--RTTLFSLPKDEEKKKEWLRKIPTDFSG 46
BLAST of EMLSAG00000012818 vs. Select Arthropod Genomes
Match: gb|KFM59055.1| (hypothetical protein X975_18203, partial [Stegodyphus mimosarum]) HSP 1 Score: 47.3654 bits (111), Expect = 1.222e-8 Identity = 24/48 (50.00%), Postives = 27/48 (56.25%), Query Frame = 0 Query: 12 MPNKCCVPKCSSGYDGKPAIARLSLHSFPLDESSKGVWLRAIPRDSNG 59 MPNKC V C S YD + R +L S P DE K WLR IP D +G Sbjct: 1 MPNKCSVAGCRSNYDTEKE--RTTLFSLPKDEEKKKEWLRKIPTDFSG 46
BLAST of EMLSAG00000012818 vs. Select Arthropod Genomes
Match: gb|KFM62072.1| (hypothetical protein X975_13847, partial [Stegodyphus mimosarum]) HSP 1 Score: 46.595 bits (109), Expect = 1.319e-7 Identity = 24/48 (50.00%), Postives = 27/48 (56.25%), Query Frame = 0 Query: 12 MPNKCCVPKCSSGYDGKPAIARLSLHSFPLDESSKGVWLRAIPRDSNG 59 MPNKC V C S YD + R +L S P DE K WLR IP D +G Sbjct: 1 MPNKCSVAGCRSNYDTEKE--RTTLFSLPKDEEKKKEWLRKIPTDFSG 46
BLAST of EMLSAG00000012818 vs. Select Arthropod Genomes
Match: gb|KFM62140.1| (hypothetical protein X975_13197, partial [Stegodyphus mimosarum]) HSP 1 Score: 47.3654 bits (111), Expect = 1.467e-7 Identity = 24/48 (50.00%), Postives = 27/48 (56.25%), Query Frame = 0 Query: 12 MPNKCCVPKCSSGYDGKPAIARLSLHSFPLDESSKGVWLRAIPRDSNG 59 MPNKC V C S YD + R +L S P DE K WLR IP D +G Sbjct: 1 MPNKCSVAGCRSNYDTEKE--RTTLFSLPKDEEKKKEWLRKIPTDFSG 46
BLAST of EMLSAG00000012818 vs. Select Arthropod Genomes
Match: gb|KFM60107.1| (Transposable element P transposase, partial [Stegodyphus mimosarum]) HSP 1 Score: 46.9802 bits (110), Expect = 2.818e-7 Identity = 20/44 (45.45%), Postives = 26/44 (59.09%), Query Frame = 0 Query: 12 MPNKCCVPKCSSGYDGKPAIARLSLHSFPLDESSKGVWLRAIPR 55 MP++CCVP C S YD A +S+ FP D K +W + IPR Sbjct: 1 MPDRCCVPGCQSNYD--KAGTYVSVFKFPKDVEKKSIWCKKIPR 42 The following BLAST results are available for this feature:
BLAST of EMLSAG00000012818 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000012818 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 2
BLAST of EMLSAG00000012818 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 5
BLAST of EMLSAG00000012818 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000012818 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 7
BLAST of EMLSAG00000012818 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000012818 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s977:162868..163832- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000012818-695584 ID=EMLSAG00000012818-695584|Name=EMLSAG00000012818|organism=Lepeophtheirus salmonis|type=gene|length=965bp|location=Sequence derived from alignment at LSalAtl2s977:162868..163832- (Lepeophtheirus salmonis)back to top Add to Basket
|