predicted protein, maker-scaffold993_size72668-snap-gene-0.16 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of predicted protein vs. L. salmonis genes
Match: EMLSAG00000001288 (supercontig:LSalAtl2s:LSalAtl2s1214:28727:33366:1 gene:EMLSAG00000001288 transcript:EMLSAT00000001288 description:"maker-LSalAtl2s1214-snap-gene-0.50") HSP 1 Score: 89.7373 bits (221), Expect = 4.751e-25 Identity = 42/78 (53.85%), Postives = 60/78 (76.92%), Query Frame = 0 Query: 44 ILSMILMVVAIGSLIEAYRISQLSDQSYPWSPCNSFEATKKNCPLGQACLKLKAYKS-YAWNWAMRCQSREEYIQRVE 120 ++ IL+++ +AY++ D SYPW+ C+ FEA+KKNCP+G+ACLKLK++ + YAWNWAMRCQSREEYIQ+ + Sbjct: 5 LIGSILILLGFVLSTQAYQLIAQYD-SYPWTKCSPFEASKKNCPVGEACLKLKSFSTGYAWNWAMRCQSREEYIQQED 81 The following BLAST results are available for this feature:
BLAST of predicted protein vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of predicted protein vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of predicted protein vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold993_size72668:56412..57348+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold993_size72668-snap-gene-0.16 ID=maker-scaffold993_size72668-snap-gene-0.16|Name=predicted protein|organism=Tigriopus kingsejongensis|type=gene|length=937bp|location=Sequence derived from alignment at scaffold993_size72668:56412..57348+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'predicted protein' has the following synonyms
Add to Basket
|