dna primase, snap_masked-scaffold181_size278858-processed-gene-1.22 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of dna primase vs. L. salmonis genes
Match: EMLSAG00000006432 (supercontig:LSalAtl2s:LSalAtl2s351:505906:522411:1 gene:EMLSAG00000006432 transcript:EMLSAT00000006432 description:"maker-LSalAtl2s351-augustus-gene-5.15") HSP 1 Score: 46.9802 bits (110), Expect = 1.221e-7 Identity = 43/92 (46.74%), Postives = 49/92 (53.26%), Query Frame = 0 Query: 4 LFQRELESPTPKRQRLSPPTLEMLDHLHQ---HCVSPPIIVRRGNRAAFWHTPQERCHTPSHGRGNGPRRTPPNNPTRRSPPQLRRSIRQRE 92 RELESPTPKRQR S + +MLD L Q PP RR N + WH RC TP + RR+P RRSP QLRRS R R+ Sbjct: 131 FLYRELESPTPKRQRFS--SQDMLDQLVQCSTPPPPPPPTTRRRNTSQRWHQEPSRCITPQR-NASSLRRSP--QQARRSPQQLRRSTRYRQ 217 The following BLAST results are available for this feature:
BLAST of dna primase vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of dna primase vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of dna primase vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold181_size278858:182255..183929- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>snap_masked-scaffold181_size278858-processed-gene-1.22 ID=snap_masked-scaffold181_size278858-processed-gene-1.22|Name=dna primase|organism=Tigriopus kingsejongensis|type=gene|length=1675bp|location=Sequence derived from alignment at scaffold181_size278858:182255..183929- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'dna primase' has the following synonyms
Add to Basket
|