transcription factor partial, snap_masked-scaffold619_size123246-processed-gene-0.28 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of transcription factor partial vs. L. salmonis genes
Match: EMLSAG00000001681 (supercontig:LSalAtl2s:LSalAtl2s128:838618:857555:-1 gene:EMLSAG00000001681 transcript:EMLSAT00000001681 description:"maker-LSalAtl2s128-snap-gene-8.19") HSP 1 Score: 53.5286 bits (127), Expect = 5.321e-9 Identity = 26/52 (50.00%), Postives = 37/52 (71.15%), Query Frame = 0 Query: 97 KKSKKFQK--EYGRLKHLVPALTEREDLSKVEIVEETIRYIDALHHQLASRI 146 KK +K+ + EY RL+ +VPA+ + +SK EI+EE I+YID+LH QL S I Sbjct: 80 KKYRKYARNMEYRRLRSIVPAVAHKRGVSKGEILEEAIKYIDSLHEQLISTI 131
BLAST of transcription factor partial vs. L. salmonis genes
Match: EMLSAG00000001141 (supercontig:LSalAtl2s:LSalAtl2s118:431419:431791:-1 gene:EMLSAG00000001141 transcript:EMLSAT00000001141 description:"maker-LSalAtl2s118-augustus-gene-4.18") HSP 1 Score: 46.2098 bits (108), Expect = 3.127e-7 Identity = 24/56 (42.86%), Postives = 34/56 (60.71%), Query Frame = 0 Query: 92 SAAELKKSKKFQKEYGRLKHLVPAL-TEREDLSKVEIVEETIRYIDALHHQLASRI 146 S ELK F K+ +LK L+P + T +D+S VE++EE RYI+ LH L +I Sbjct: 2 SRKELKFQSAFDKDLSKLKQLIPGMNTSGKDVSHVEVIEEANRYIEKLHSHLVCQI 57 The following BLAST results are available for this feature:
BLAST of transcription factor partial vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 2
BLAST of transcription factor partial vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of transcription factor partial vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold619_size123246:118316..120051- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>snap_masked-scaffold619_size123246-processed-gene-0.28 ID=snap_masked-scaffold619_size123246-processed-gene-0.28|Name=transcription factor partial|organism=Tigriopus kingsejongensis|type=gene|length=1736bp|location=Sequence derived from alignment at scaffold619_size123246:118316..120051- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'transcription factor partial' has the following synonyms
Add to Basket
|