microtubule-actin cross-linking factor 1 isoform x6, maker-scaffold148_size310697-snap-gene-2.14 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of microtubule-actin cross-linking factor 1 isoform x6 vs. L. salmonis genes
Match: EMLSAG00000005204 (supercontig:LSalAtl2s:LSalAtl2s274:335483:419694:1 gene:EMLSAG00000005204 transcript:EMLSAT00000005204 description:"maker-LSalAtl2s274-snap-gene-3.27") HSP 1 Score: 53.5286 bits (127), Expect = 1.148e-8 Identity = 27/50 (54.00%), Postives = 33/50 (66.00%), Query Frame = 0 Query: 128 EDLEDDVDSIRSPFYKPRTPLRYPLSPQSPPSDESSYQGSIPGSAPSDRS 177 +DL DD+DSIRSPFYK R PL YP+SP + DESS+ + G D S Sbjct: 1094 QDLSDDLDSIRSPFYKQRIPLTYPISP-NHSEDESSFHEEVGGGTSHDDS 1142 The following BLAST results are available for this feature:
BLAST of microtubule-actin cross-linking factor 1 isoform x6 vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of microtubule-actin cross-linking factor 1 isoform x6 vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of microtubule-actin cross-linking factor 1 isoform x6 vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold148_size310697:235295..237866- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold148_size310697-snap-gene-2.14 ID=maker-scaffold148_size310697-snap-gene-2.14|Name=microtubule-actin cross-linking factor 1 isoform x6|organism=Tigriopus kingsejongensis|type=gene|length=2572bp|location=Sequence derived from alignment at scaffold148_size310697:235295..237866- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'microtubule-actin cross-linking factor 1 isoform x6' has the following synonyms
Add to Basket
|