EMLSAP00000005382, EMLSAP00000005382 (polypeptide) Lepeophtheirus salmonis

Overview
NameEMLSAP00000005382
Unique NameEMLSAP00000005382
Typepolypeptide
OrganismLepeophtheirus salmonis (salmon louse)
Sequence length559
Associated RNAi Experiments

Nothing found

InterPro
Analysis Name: InterproScan 5
Date Performed: 2014-05-02
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002159CD36 antigenPRINTSPR01609CD36FAMILYcoord: 407..431
score: 31.86
coord: 454..475
score: 43.57
coord: 55..76
score: 31.03
coord: 80..92
score: 49.6
IPR002159CD36 antigenPFAMPF01130CD36coord: 12..550
e-value: 4.0E-105
score: 351.6
IPR002159CD36 antigenPANTHERPTHR11923SCAVENGER RECEPTOR CLASS B TYPE-1 (SR-B1)coord: 6..555
NoneNo IPR availableTMHMMTMhelixcoord: 2..24
NoneNo IPR availableTMHMMTMhelixcoord: 529..551

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
EBI Gene Prediction Pipeline2013-07-17
InterproScan 52014-05-02
InterproScan 5, GO-Slims (generic)2014-05-10
Properties
Property NameValue
NoteHeme binding
Cross References
External references for this polypeptide
DatabaseAccession
Ensembl Metazoa (protein)EMLSAP00000005382 (primary cross-reference)
genbankCDW29028.1
genbank:proteinCDW29028.1
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
EMLSAT00000005382EMLSAT00000005382-701229Lepeophtheirus salmonismRNA


Synonyms
The feature 'EMLSAP00000005382' has the following synonyms
Synonym
LsHSCARB
SCARB
Sequences
The following sequences are available for this feature:

polypeptide sequence

>EMLSAP00000005382 ID=EMLSAP00000005382|Name=EMLSAP00000005382|organism=Lepeophtheirus salmonis|type=polypeptide|length=559bp
MILYSIRVILGLLSIVLIIGGISLKMHILPAMIKSQIYENLDLREGTEGF
NAFKEPPAPVYLSYSLFHIKNTNEVIRGEPPVLLEVGPYSYRETMRKENL
MEQNSRYLSYGKYTKFEFDETNTHKLKCKNRINTPCSKNDKITIINPVLL
TLADKLDGLPKTVKDICFEIINNGNEALGIKAEDLFITEEVDKILYTGFD
SKSAAIFDKLDTFLMLLLEVIQESLELDIPIKAKDFENIIKIISPAQLSE
GTFAFFKGKNATKLQNYYTIENGRFDKESFMNIVEFNGKNKLPEAXWPNV
ATSITGQLSSEGGSCHRIYGTDGTQFPPFLFNKKKFPLWMFVGELCRTIY
VEFESEVEVEGGITAYRYGVGKRVFSMSNPENFCYCQEFFSCAKQTDNDE
WDLSQCLKCKDGVMDVSACYGAPIFMSQPHFLQADKEVQAYVKGLEPNSE
KHATYLDIEPNLGTPLRAHKKIQINMVLRKVAGIDLLKKVADFRLIPMFW
ADEGAELDSEKAEELNNVLFSAITIGNTVGIALGYVVGPILLIVSIILSF
YQRYREKRA
back to top
Add to Basket