|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterproScan 5
Date Performed: 2014-05-02
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR001806 | Small GTPase superfamily | PRINTS | PR00449 | RASTRNSFRMNG | coord: 9..30
score: 0.0
coord: 49..71
score: 0.0
coord: 110..123
score: 0.0
coord: 158..180
score: 0.0
coord: 32..48
score: 0.0 |
| IPR001806 | Small GTPase superfamily | PFAM | PF00071 | Ras | coord: 10..180
e-value: 3.2E-49
score: 0.0 |
| IPR003578 | Small GTPase superfamily, Rho type | SMART | SM00174 | RHO | coord: 11..183
e-value: 2.299984205E-110
score: 0.0 |
| IPR003578 | Small GTPase superfamily, Rho type | PROSITE | PS51420 | RHO | coord: 2..180
score: 0.0 |
| IPR005225 | Small GTP-binding protein domain | TIGRFAM | TIGR00231 | TIGR00231 | coord: 7..160
e-value: 2.3E-33
score: 0.0 |
| None | No IPR available | GENE3D | 3.40.50.300 | | coord: 7..185
e-value: 2.3E-57
score: 0.0 |
| None | No IPR available | PANTHER | PTHR24072 | RHO FAMILY GTPASE | coord: 6..184 |
| IPR027417 | P-loop containing nucleoside triphosphate hydrolase | SUPERFAMILY | 52540 | P-loop containing nucleoside triphosphate hydrolases | coord: 7..177 |
Analyses
This polypeptide is derived from or has results from the following analyses
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EMLSAP00000000691 ID=EMLSAP00000000691|Name=EMLSAP00000000691|organism=Lepeophtheirus salmonis|type=polypeptide|length=204bp
MTEFDPKTIKCVVVGDGAVGKTCMLISYATDKFPQEYVPTVFDNYMVNVM
IGDDPYTLGLFDTAGQEDYDNLRHLCYPNTDIFLVCFSVIRPNSFANVRQ
KWSSEVKKYYKAPILLVGTQVDLRNDEKTKEALSKCKQKPITEEQGRSLA
KEIGAVRYSECSAITQNGLKDVFDEAIIAVLERPSSGKEDSNGGNPLRAC
CKAM back to top
|
