EMLSAP00000006683, EMLSAP00000006683 (polypeptide) Lepeophtheirus salmonis

Overview


Name	EMLSAP00000006683
Unique Name	EMLSAP00000006683
Type	polypeptide
Organism	Lepeophtheirus salmonis (salmon louse)
Sequence length	134

Associated RNAi Experiments

Nothing found

InterPro

Analysis Name: InterproScan 5
Date Performed: 2014-05-02


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
IPR019184	Uncharacterised protein family, transmembrane-17	PFAM	PF09799	Transmemb_17	coord: 9..116 e-value: 2.5E-19 score: 69.4
None	No IPR available	PANTHER	PTHR13531	FAMILY NOT NAMED	coord: 5..132
None	No IPR available	PANTHER	PTHR13531:SF0	SUBFAMILY NOT NAMED	coord: 5..132
None	No IPR available	TMHMM	TMhelix		coord: 42..64
None	No IPR available	TMHMM	TMhelix		coord: 13..35
None	No IPR available	TMHMM	TMhelix		coord: 74..96
None	No IPR available	TMHMM	TMhelix		coord: 103..125

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
EBI Gene Prediction Pipeline	2013-07-17
InterproScan 5	2014-05-02

Cross References

External references for this polypeptide


Database	Accession
Ensembl Metazoa (protein)	EMLSAP00000006683 (primary cross-reference)

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type
EMLSAT00000006683	EMLSAT00000006683-702530	Lepeophtheirus salmonis	mRNA

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>EMLSAP00000006683 ID=EMLSAP00000006683|Name=EMLSAP00000006683|organism=Lepeophtheirus salmonis|type=polypeptide|length=134bp
MKSLLSFQIFLHLGAWYFGSFCLAEVLLNIYKYVAFPNTFQNLFINFGIL
VLTGLLETLRIFTGWKGNLVQNVYLIGISIVLIVPGILGVLYIMLWQIYV
VKLEVILCSVQLTLQGIQLIFAIISSISIYSSSH

Add to Basket

Search form