|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterproScan 5
Date Performed: 2014-05-02
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR002030 | Mitochondrial brown fat uncoupling protein | PRINTS | PR00784 | MTUNCOUPLING | coord: 24..41
score: 50.85
coord: 67..85
score: 51.01
coord: 144..162
score: 22.03 |
| IPR018108 | Mitochondrial substrate/solute carrier | PFAM | PF00153 | Mito_carr | coord: 71..159
e-value: 5.4E-20
score: 70.7
coord: 5..64
e-value: 7.2E-12
score: 44.7 |
| IPR018108 | Mitochondrial substrate/solute carrier | PROSITE | PS50920 | SOLCAR | coord: 1..61
score: 18.158 |
| IPR018108 | Mitochondrial substrate/solute carrier | PROSITE | PS50920 | SOLCAR | coord: 70..155
score: 24.229 |
| IPR023395 | Mitochondrial carrier domain | GENE3D | 1.50.40.10 | | coord: 1..154
e-value: 4.2E-39
score: 133.4 |
| IPR023395 | Mitochondrial carrier domain | SUPERFAMILY | 103506 | Mitochondrial carrier | coord: 1..152 |
| None | No IPR available | PANTHER | PTHR24089 | FAMILY NOT NAMED | coord: 1..162 |
| None | No IPR available | PANTHER | PTHR24089:SF82 | SUBFAMILY NOT NAMED | coord: 1..162 |
| None | No IPR available | TMHMM | TMhelix | | coord: 71..93 |
| None | No IPR available | TMHMM | TMhelix | | coord: 133..150 |
Analyses
This polypeptide is derived from or has results from the following analyses
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EMLSAP00000009039 ID=EMLSAP00000009039|Name=EMLSAP00000009039|organism=Lepeophtheirus salmonis|type=polypeptide|length=162bp
MQAETRRPGEAKRYTGVMNAYTTIGKTEGFKGLYRGTMPNIARNCIINIS
EIVVYDIMKETLMTSFNMKDGVPCHFTAAVMAGFAATLMAXPVDVIKTRF
MNSPEGKYRGVIHCAYETGRNEGISAYYKGFNASFSRLVTWNIFLWLVFE
QMKKRIMTYNES back to top
|
