|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterproScan 5
Date Performed: 2014-05-02
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR002067 | Mitochondrial carrier protein | PRINTS | PR00926 | MITOCARRIER | coord: 74..94
score: 75.33
coord: 133..151
score: 20.97
coord: 24..38
score: 76.17
coord: 11..24
score: 50.59 |
| IPR002113 | Adenine nucleotide translocator 1 | PRINTS | PR00927 | ADPTRNSLCASE | coord: 8..20
score: 40.38
coord: 52..73
score: 46.56
coord: 85..97
score: 60.37 |
| IPR018108 | Mitochondrial substrate/solute carrier | PFAM | PF00153 | Mito_carr | coord: 5..92
e-value: 7.3E-21
score: 73.5 |
| IPR018108 | Mitochondrial substrate/solute carrier | PROSITE | PS50920 | SOLCAR | coord: 6..99
score: 22.062 |
| IPR023395 | Mitochondrial carrier domain | GENE3D | 1.50.40.10 | | coord: 4..93
e-value: 1.6E-21
score: 75.7 |
| IPR023395 | Mitochondrial carrier domain | SUPERFAMILY | 103506 | Mitochondrial carrier | coord: 4..101 |
| None | No IPR available | PANTHER | PTHR24089 | FAMILY NOT NAMED | coord: 12..92 |
| None | No IPR available | PANTHER | PTHR24089:SF31 | SUBFAMILY NOT NAMED | coord: 12..92 |
| None | No IPR available | TMHMM | TMhelix | | coord: 117..139 |
Analyses
This polypeptide is derived from or has results from the following analyses
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EMLSAP00000009483 ID=EMLSAP00000009483|Name=EMLSAP00000009483|organism=Lepeophtheirus salmonis|type=polypeptide|length=156bp
MGKQELSFVESFMLSGVAAGVSKTAAAPIERVKLLVQNQGEMLKQGXLDK
PYSGVVDCTKRTLQTEGMAAFWRGNLANVIRYFPTQALNFAFXXXSPSLE
PARTHPIPKNSPRTSCLVGVLDPCLSLLFILLTTLVLVWPMMLNPARREV
NVNLMV back to top
|
