|
Associated RNAi Experiments
InterPro
Analysis Name: InterproScan 5
Date Performed: 2014-05-02
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | PRINTS | PR01705 | TSP1REPEAT | coord: 497..508 score: 31.18 coord: 478..489 score: 44.49 coord: 232..245 score: 52.3 |
None | No IPR available | GENE3D | 2.20.100.10 | | coord: 399..441 e-value: 5.1E-12 score: 45.3 coord: 344..390 e-value: 2.6E-13 score: 49.5 coord: 232..283 e-value: 9.1E-11 score: 41.3 coord: 285..337 e-value: 1.3E-16 score: 60.1 coord: 458..513 e-value: 2.3E-18 score: 65.7 coord: 515..554 e-value: 3.3E-12 score: 46.0 |
None | No IPR available | PANTHER | PTHR19897 | COILED-COIL DOMAIN-CONTAINING PROTEIN | coord: 232..554 |
None | No IPR available | PANTHER | PTHR19897:SF72 | HEMICENTIN-1 | coord: 232..554 |
IPR000742 | Epidermal growth factor-like domain | SMART | SM00181 | EGF | coord: 136..167 e-value: 0.0026 score: 27.0 coord: 108..135 e-value: 200.0 score: 1.1 coord: 170..200 e-value: 13.0 score: 14.7 coord: 43..74 e-value: 20.0 score: 12.5 coord: 75..105 e-value: 0.034 score: 23.3 |
IPR000742 | Epidermal growth factor-like domain | PROSITE | PS50026 | EGF_3 | coord: 167..200 score: 8.488 |
IPR000742 | Epidermal growth factor-like domain | PROSITE | PS50026 | EGF_3 | coord: 69..105 score: 7.63 |
IPR000884 | Thrombospondin, type 1 repeat | SMART | SM00209 | TSP1 | coord: 462..514 e-value: 3.3E-15 score: 66.5 coord: 519..555 e-value: 0.0021 score: 27.3 coord: 234..284 e-value: 9.2E-8 score: 41.8 coord: 346..398 e-value: 4.3E-7 score: 39.6 coord: 403..457 e-value: 4.5E-6 score: 36.2 coord: 289..341 e-value: 2.7E-9 score: 46.9 |
IPR000884 | Thrombospondin, type 1 repeat | PFAM | PF00090 | TSP_1 | coord: 291..337 e-value: 1.4E-9 score: 37.8 coord: 463..513 e-value: 6.1E-13 score: 48.5 coord: 235..283 e-value: 4.7E-7 score: 29.7 coord: 520..554 e-value: 1.2E-10 score: 41.2 coord: 404..442 e-value: 2.6E-7 score: 30.5 coord: 347..389 e-value: 4.4E-8 score: 32.9 |
IPR000884 | Thrombospondin, type 1 repeat | PROSITE | PS50092 | TSP1 | coord: 516..554 score: 10.688 |
IPR000884 | Thrombospondin, type 1 repeat | PROSITE | PS50092 | TSP1 | coord: 459..514 score: 14.092 |
IPR000884 | Thrombospondin, type 1 repeat | PROSITE | PS50092 | TSP1 | coord: 343..398 score: 10.085 |
IPR000884 | Thrombospondin, type 1 repeat | PROSITE | PS50092 | TSP1 | coord: 231..284 score: 12.043 |
IPR000884 | Thrombospondin, type 1 repeat | PROSITE | PS50092 | TSP1 | coord: 286..341 score: 12.717 |
IPR000884 | Thrombospondin, type 1 repeat | PROSITE | PS50092 | TSP1 | coord: 400..457 score: 10.479 |
IPR000884 | Thrombospondin, type 1 repeat | SUPERFAMILY | 82895 | TSP-1 type 1 repeat | coord: 455..513 |
IPR000884 | Thrombospondin, type 1 repeat | SUPERFAMILY | 82895 | TSP-1 type 1 repeat | coord: 231..279 |
IPR000884 | Thrombospondin, type 1 repeat | SUPERFAMILY | 82895 | TSP-1 type 1 repeat | coord: 513..554 |
IPR000884 | Thrombospondin, type 1 repeat | SUPERFAMILY | 82895 | TSP-1 type 1 repeat | coord: 283..340 |
IPR000884 | Thrombospondin, type 1 repeat | SUPERFAMILY | 82895 | TSP-1 type 1 repeat | coord: 340..397 |
IPR000884 | Thrombospondin, type 1 repeat | SUPERFAMILY | 82895 | TSP-1 type 1 repeat | coord: 397..443 |
IPR013032 | EGF-like, conserved site | PFAM | PF12661 | hEGF | coord: 122..134 e-value: 0.0025 score: 17.6 |
IPR013032 | EGF-like, conserved site | PROSITE | PS00022 | EGF_1 | coord: 188..199 |
IPR013032 | EGF-like, conserved site | PROSITE | PS01186 | EGF_2 | coord: 155..166 |
IPR013032 | EGF-like, conserved site | PROSITE | PS00022 | EGF_1 | coord: 93..104 |
IPR013032 | EGF-like, conserved site | PROSITE | PS00022 | EGF_1 | coord: 155..166 |
IPR013032 | EGF-like, conserved site | PROSITE | PS00022 | EGF_1 | coord: 123..134 |
IPR013032 | EGF-like, conserved site | PROSITE | PS01186 | EGF_2 | coord: 123..137 |
IPR013032 | EGF-like, conserved site | PROSITE | PS00022 | EGF_1 | coord: 62..73 |
IPR013032 | EGF-like, conserved site | PROSITE | PS01186 | EGF_2 | coord: 93..104 |
IPR013032 | EGF-like, conserved site | PROSITE | PS01186 | EGF_2 | coord: 62..76 |
IPR013032 | EGF-like, conserved site | PROSITE | PS01186 | EGF_2 | coord: 188..202 |
Analyses
This polypeptide is derived from or has results from the following analyses
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EMLSAP00000010397 ID=EMLSAP00000010397|Name=EMLSAP00000010397|organism=Lepeophtheirus salmonis|type=polypeptide|length=556bp MIFRGATVQFIYYLSNKYTCDSIGNVICLPGWSQPEHLCETPVCSIEGRS CVNGECIFPNVCSCEIGWDGPSCAECIPLAGCQHGSCKGALECNCEPGWX GGQCEKPKCNDCVNGCCHEPNKCICDPGWQGINCTECETLSNCINGKCFK KPFECVCNPGWKGNGCAEPICRDTCHPENGYCQRPGECICKHGWXGRDCT ECVPYPDCNGTCVNNVPWTCTDLGTDNEAKPGQWSLWSTWSSCSKSCGDG EQRRDRTCGNGERSQQNCVGQSSQGQSCVIANCKIDGEWARWTRWSPCST SCGTGFRSRSRACSDPIPRYGGNRCSGSPTETVKCFSTFCPIAGRWSSWQ ZWGQLSVSCGEGTRQRQRRCDSPAPAHRGASCIGESSQTNTLFIKECPVD AEWSLWSRWTACSKSCDRGQKSRMRHCGEPLFGGQSCPGNITIEKDVIDC WVRQVCTVDGKWSNWLEWSSCTVTCGGGTRQRRRNCDNPAPKFGGQRCLG SEFDTQNCETDSCPIDGRWSQWRQWSQCSKTCGSGSQKRERVCNNPRFGG KACTVW back to top
|