upf0197 transmembrane protein c11orf10 homolog, maker-scaffold110_size354795-snap-gene-2.21 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. L. salmonis genes
Match: EMLSAG00000009604 (supercontig:LSalAtl2s:LSalAtl2s617:45538:54292:1 gene:EMLSAG00000009604 transcript:EMLSAT00000009604 description:"maker-LSalAtl2s617-snap-gene-0.31") HSP 1 Score: 119.398 bits (298), Expect = 2.013e-30 Identity = 55/87 (63.22%), Postives = 71/87 (81.61%), Query Frame = 0 Query: 228 AEILGILKIPFVLVSLDGYARYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 A + + K+ ++ ++ R+ SPVNPA+YPHL++VLL IGLFFTA FF YEVTSTKFTRE +KE+LIS+IAS+FMG+GTLFLLLW Sbjct: 257 ATFISLPKVSGTMIKIEHMQRFASPVNPAIYPHLSLVLLGIGLFFTAXFFXYEVTSTKFTREPIKEVLISVIASLFMGLGTLFLLLW 343
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. SwissProt
Match: gi|47117653|sp|P61165.1|TM258_HUMAN (RecName: Full=Transmembrane protein 258 >gi|47117654|sp|P61166.1|TM258_MOUSE RecName: Full=Transmembrane protein 258 >gi|82130508|sp|Q76LT9.1|TM258_CHICK RecName: Full=Transmembrane protein 258; AltName: Full=Protein NEF1) HSP 1 Score: 124.405 bits (311), Expect = 1.090e-33 Identity = 53/74 (71.62%), Postives = 65/74 (87.84%), Query Frame = 0 Query: 241 VSLDGYARYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 + L+ +RY SPVNPA++PHL VVLL IG+FFTAWFFVYEVTSTK+TR+I KE+LIS++AS+FMG G LFLLLW Sbjct: 1 MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLW 74
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. SwissProt
Match: gi|97046730|sp|Q32P84.1|TM258_BOVIN (RecName: Full=Transmembrane protein 258) HSP 1 Score: 124.405 bits (311), Expect = 1.090e-33 Identity = 53/74 (71.62%), Postives = 65/74 (87.84%), Query Frame = 0 Query: 241 VSLDGYARYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 + L+ +RY SPVNPA++PHL VVLL IG+FFTAWFFVYEVTSTK+TR+I KE+LIS++AS+FMG G LFLLLW Sbjct: 1 MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLW 74
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. SwissProt
Match: gi|82182402|sp|Q6DDB3.1|TM258_XENTR (RecName: Full=Transmembrane protein 258 >gi|82184385|sp|Q6GP81.1|TM258_XENLA RecName: Full=Transmembrane protein 258) HSP 1 Score: 123.635 bits (309), Expect = 1.850e-33 Identity = 52/74 (70.27%), Postives = 65/74 (87.84%), Query Frame = 0 Query: 241 VSLDGYARYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 + L+ +RY SPVNPA++PHL VVLL IG+FFTAWFFVYEVTSTK+TR++ KE+LIS++AS+FMG G LFLLLW Sbjct: 1 MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVASLFMGFGVLFLLLW 74
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. SwissProt
Match: gi|82186960|sp|Q6PBS6.1|TM258_DANRE (RecName: Full=Transmembrane protein 258) HSP 1 Score: 117.087 bits (292), Expect = 5.534e-31 Identity = 49/74 (66.22%), Postives = 62/74 (83.78%), Query Frame = 0 Query: 241 VSLDGYARYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 + L+ RY SPVNPA++PHL VVLL IG+FF AWFFVYEVTSTK+TR++ KE+LI+++AS+FMG G FLLLW Sbjct: 1 MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFKAWFFVYEVTSTKYTRDVYKELLIALVASLFMGFGVHFLLLW 74
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. SwissProt
Match: gi|20532296|sp|Q9VVA8.1|TM258_DROME (RecName: Full=Transmembrane protein 258 homolog) HSP 1 Score: 95.1301 bits (235), Expect = 6.629e-23 Identity = 44/73 (60.27%), Postives = 59/73 (80.82%), Query Frame = 0 Query: 243 LDGYARYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTRE--IVKEILISMIASIFMGMGTLFLLL 313 +D RY+SPVNPA++PHLA VLL+IG FFTAWFF++ V S K ++E ++KE+LIS+ ASIF+G G +FLLL Sbjct: 1 MDVMQRYVSPVNPAVFPHLATVLLVIGTFFTAWFFIF-VVSRKSSKESTLIKELLISLCASIFLGFGIVFLLL 72
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. SwissProt
Match: gi|20532287|sp|Q965T1.1|TM258_CAEEL (RecName: Full=Transmembrane protein 258 homolog) HSP 1 Score: 69.707 bits (169), Expect = 8.884e-14 Identity = 31/67 (46.27%), Postives = 45/67 (67.16%), Query Frame = 0 Query: 248 RYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 RY +PVN A P L L +GL A F + +VTSTK+ R ++KE+ I+ +S+F+G G++FLLLW Sbjct: 8 RYTAPVNFASLPLLTTFLCGVGLLLLATFTMIQVTSTKYNRNLLKELFIAATSSVFLGFGSVFLLLW 74
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. SwissProt
Match: gi|74789359|sp|Q60WL8.1|TM258_CAEBR (RecName: Full=Transmembrane protein 258 homolog) HSP 1 Score: 60.4622 bits (145), Expect = 1.344e-10 Identity = 32/67 (47.76%), Postives = 46/67 (68.66%), Query Frame = 0 Query: 248 RYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 RY +PV+ + P LA VL +GL A F + +VTSTK+ R + KE+ I+ +SIF+G G++FLLLW Sbjct: 8 RYAAPVHFSSLPLLATVLCGVGLLLLAAFTMLQVTSTKYNRNVFKELFIAATSSIFLGFGSVFLLLW 74
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. nr
Match: gi|1133448403|ref|XP_019850650.1| (PREDICTED: transmembrane protein 258-like [Amphimedon queenslandica]) HSP 1 Score: 127.102 bits (318), Expect = 2.701e-32 Identity = 55/74 (74.32%), Postives = 66/74 (89.19%), Query Frame = 0 Query: 241 VSLDGYARYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 + LD YARY+SPVNPA+YPHLAV+LL IGLFF AWFFVYEVTSTKF+R I+KE+L+S+ A++F G GTLFLLLW Sbjct: 1 MDLDNYARYVSPVNPAVYPHLAVILLGIGLFFMAWFFVYEVTSTKFSRRIMKELLVSLWAAVFTGFGTLFLLLW 74
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. nr
Match: gi|290462911|gb|ADD24503.1| (UPF0197 transmembrane protein C11orf10 homolog [Lepeophtheirus salmonis] >gi|290562637|gb|ADD38714.1| UPF0197 transmembrane protein C11orf10 homolog [Lepeophtheirus salmonis]) HSP 1 Score: 127.102 bits (318), Expect = 3.459e-32 Identity = 55/75 (73.33%), Postives = 68/75 (90.67%), Query Frame = 0 Query: 240 LVSLDGYARYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 ++ ++ R+ SPVNPA+YPHL++VLL IGLFFTAWFFVYEVTSTKFTRE +KE+LIS+IAS+FMG+GTLFLLLW Sbjct: 1 MIKIEHMQRFASPVNPAIYPHLSLVLLGIGLFFTAWFFVYEVTSTKFTREPIKEVLISVIASLFMGLGTLFLLLW 75
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. nr
Match: gi|1025029264|ref|XP_016324440.1| (PREDICTED: transmembrane protein 258-like [Sinocyclocheilus anshuiensis]) HSP 1 Score: 126.716 bits (317), Expect = 1.682e-31 Identity = 55/82 (67.07%), Postives = 68/82 (82.93%), Query Frame = 0 Query: 233 ILKIPFVLVSLDGYARYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 IL +P + L+ RY SPVNPA++PHL VVLL IG+FFTAWFFVYEVTSTK+TR++ KE+LIS++AS+FMG G LFLLLW Sbjct: 35 ILPLPCHTMELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDLYKELLISLVASLFMGFGVLFLLLW 116
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. nr
Match: gi|685585824|ref|XP_009184128.1| (transmembrane protein 258 isoform X1 [Papio anubis]) HSP 1 Score: 125.176 bits (313), Expect = 2.169e-31 Identity = 53/74 (71.62%), Postives = 65/74 (87.84%), Query Frame = 0 Query: 241 VSLDGYARYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 + L+ +RY SPVNPA++PHL VVLL IG+FFTAWFFVYEVTSTK+TR+I KE+LIS++AS+FMG G LFLLLW Sbjct: 9 IELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLW 82
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. nr
Match: gi|303519137|ref|NP_001181992.1| (transmembrane protein 258 [Bos taurus] >gi|426251860|ref|XP_004019639.1| PREDICTED: transmembrane protein 258 [Ovis aries] >gi|548527672|ref|XP_005699820.1| PREDICTED: transmembrane protein 258 [Capra hircus] >gi|555978816|ref|XP_005901345.1| PREDICTED: transmembrane protein 258 [Bos mutus] >gi|556742597|ref|XP_005966820.1| PREDICTED: transmembrane protein 258 [Pantholops hodgsonii] >gi|594032337|ref|XP_006040939.1| PREDICTED: transmembrane protein 258 [Bubalus bubalis] >gi|742179172|ref|XP_010852342.1| PREDICTED: transmembrane protein 258 [Bison bison bison] >gi|803191019|ref|XP_011957384.1| PREDICTED: transmembrane protein 258 [Ovis aries] >gi|803284076|ref|XP_012001709.1| PREDICTED: transmembrane protein 258 [Ovis aries musimon] >gi|803284078|ref|XP_012001710.1| PREDICTED: transmembrane protein 258 [Ovis aries musimon] >gi|1131254247|ref|XP_019810779.1| PREDICTED: transmembrane protein 258 [Bos indicus] >gi|1187537171|ref|XP_020772536.1| transmembrane protein 258 [Odocoileus virginianus texanus] >gi|97046730|sp|Q32P84.1|TM258_BOVIN RecName: Full=Transmembrane protein 258 >gi|79160206|gb|AAI08219.1| C29H11orf10 protein [Bos taurus] >gi|296471674|tpg|DAA13789.1| TPA: chromosome 11 open reading frame 10 ortholog [Bos taurus] >gi|1207839855|gb|OWK17339.1| TMEM258 [Cervus elaphus hippelaphus]) HSP 1 Score: 124.405 bits (311), Expect = 3.378e-31 Identity = 53/74 (71.62%), Postives = 65/74 (87.84%), Query Frame = 0 Query: 241 VSLDGYARYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 + L+ +RY SPVNPA++PHL VVLL IG+FFTAWFFVYEVTSTK+TR+I KE+LIS++AS+FMG G LFLLLW Sbjct: 1 MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLW 74
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. nr
Match: gi|7656934|ref|NP_055021.1| (transmembrane protein 258 [Homo sapiens] >gi|54607185|ref|NP_001006464.1| transmembrane protein 258 [Gallus gallus] >gi|254540154|ref|NP_081195.1| transmembrane protein 258 isoform 1 [Mus musculus] >gi|347446715|ref|NP_001231531.1| transmembrane protein 258 [Macaca mulatta] >gi|291409582|ref|XP_002721065.1| PREDICTED: transmembrane protein 258 [Oryctolagus cuniculus] >gi|297688504|ref|XP_002821722.1| transmembrane protein 258 [Pongo abelii] >gi|311247495|ref|XP_003122674.1| transmembrane protein 258 [Sus scrofa] >gi|326919870|ref|XP_003206200.1| PREDICTED: transmembrane protein 258 [Meleagris gallopavo] >gi|332249909|ref|XP_003274096.1| PREDICTED: transmembrane protein 258 [Nomascus leucogenys] >gi|345783280|ref|XP_003432393.1| transmembrane protein 258 isoform X2 [Canis lupus familiaris] >gi|390470651|ref|XP_003734327.1| PREDICTED: transmembrane protein 258 [Callithrix jacchus] >gi|395545426|ref|XP_003774603.1| transmembrane protein 258 [Sarcophilus harrisii] >gi|395852528|ref|XP_003798790.1| transmembrane protein 258 [Otolemur garnettii] >gi|397516604|ref|XP_003828514.1| PREDICTED: transmembrane protein 258 [Pan paniscus] >gi|402893163|ref|XP_003909771.1| transmembrane protein 258 isoform X2 [Papio anubis] >gi|403255051|ref|XP_003920262.1| PREDICTED: transmembrane protein 258 isoform X1 [Saimiri boliviensis boliviensis] >gi|403279828|ref|XP_003931446.1| PREDICTED: transmembrane protein 258 [Saimiri boliviensis boliviensis] >gi|410045198|ref|XP_003951956.1| transmembrane protein 258 [Pan troglodytes] >gi|426368756|ref|XP_004051368.1| PREDICTED: transmembrane protein 258 [Gorilla gorilla gorilla] >gi|465976292|ref|XP_004264243.1| PREDICTED: transmembrane protein 258 [Orcinus orca] >gi|472381439|ref|XP_004410113.1| PREDICTED: transmembrane protein 258 [Odobenus rosmarus divergens] >gi|478526670|ref|XP_004437518.1| PREDICTED: transmembrane protein 258 [Ceratotherium simum simum] >gi|488595799|ref|XP_004483093.1| transmembrane protein 258 [Dasypus novemcinctus] >gi|507568187|ref|XP_004667725.1| PREDICTED: transmembrane protein 258 [Jaculus jaculus] >gi|511901743|ref|XP_004770390.1| PREDICTED: transmembrane protein 258 [Mustela putorius furo] >gi|513026386|ref|XP_004874357.1| transmembrane protein 258 [Heterocephalus glaber] >gi|514453758|ref|XP_003465918.2| transmembrane protein 258 [Cavia porcellus] >gi|524919247|ref|XP_005063907.1| transmembrane protein 258 [Mesocricetus auratus] >gi|532053894|ref|XP_005369682.1| PREDICTED: transmembrane protein 258 isoform X1 [Microtus ochrogaster] >gi|532053896|ref|XP_005369683.1| PREDICTED: transmembrane protein 258 isoform X2 [Microtus ochrogaster] >gi|533190647|ref|XP_005408199.1| PREDICTED: transmembrane protein 258 isoform X1 [Chinchilla lanigera] >gi|543371614|ref|XP_005529029.1| PREDICTED: transmembrane protein 258 [Pseudopodoces humilis] >gi|544485219|ref|XP_005577671.1| PREDICTED: transmembrane protein 258 [Macaca fascicularis] >gi|544499590|ref|XP_005584058.1| PREDICTED: transmembrane protein 258 [Macaca fascicularis] >gi|557286653|ref|XP_006026073.1| PREDICTED: transmembrane protein 258 [Alligator sinensis] >gi|560893479|ref|XP_006173244.1| PREDICTED: transmembrane protein 258 [Camelus ferus] >gi|560985463|ref|XP_006214935.1| PREDICTED: transmembrane protein 258 [Vicugna pacos] >gi|562884458|ref|XP_006169715.1| PREDICTED: transmembrane protein 258 isoform X1 [Tupaia chinensis] >gi|585156121|ref|XP_006730388.1| PREDICTED: transmembrane protein 258 [Leptonychotes weddellii] >gi|586552530|ref|XP_006911283.1| PREDICTED: transmembrane protein 258 [Pteropus alecto] >gi|589962732|ref|XP_006993920.1| PREDICTED: transmembrane protein 258 isoform X1 [Peromyscus maniculatus bairdii] >gi|591332598|ref|XP_007092046.1| PREDICTED: transmembrane protein 258 [Panthera tigris altaica] >gi|593719826|ref|XP_007106255.1| transmembrane protein 258 [Physeter catodon] >gi|594651996|ref|XP_007174489.1| PREDICTED: transmembrane protein 258 [Balaenoptera acutorostrata scammoni] >gi|602700509|ref|XP_007462233.1| PREDICTED: transmembrane protein 258 [Lipotes vexillifer] >gi|612061832|ref|XP_007506711.1| PREDICTED: transmembrane protein 258 [Monodelphis domestica] >gi|612061834|ref|XP_007506712.1| PREDICTED: transmembrane protein 258 [Monodelphis domestica] >gi|625248345|ref|XP_007615462.1| PREDICTED: transmembrane protein 258 isoform X2 [Cricetulus griseus] >gi|635012958|ref|XP_007994057.1| PREDICTED: transmembrane protein 258 isoform X1 [Chlorocebus sabaeus] >gi|640789037|ref|XP_008050338.1| transmembrane protein 258 isoform X2 [Carlito syrichta] >gi|641778723|ref|XP_008172314.1| transmembrane protein 258 isoform X2 [Chrysemys picta bellii] >gi|667319811|ref|XP_008587614.1| PREDICTED: transmembrane protein 258 isoform X1 [Galeopterus variegatus] >gi|724929924|ref|XP_010383227.1| PREDICTED: transmembrane protein 258 [Rhinopithecus roxellana] >gi|725549867|ref|XP_010333785.1| PREDICTED: transmembrane protein 258 isoform X2 [Saimiri boliviensis boliviensis] >gi|729733293|ref|XP_010562577.1| PREDICTED: transmembrane protein 258 [Haliaeetus leucocephalus] >gi|731235469|ref|XP_010631328.1| PREDICTED: transmembrane protein 258 [Fukomys damarensis] >gi|731507654|ref|XP_010597420.1| transmembrane protein 258 isoform X2 [Loxodonta africana] >gi|743721727|ref|XP_010954704.1| PREDICTED: transmembrane protein 258 [Camelus bactrianus] >gi|744585152|ref|XP_010985266.1| PREDICTED: transmembrane protein 258 [Camelus dromedarius] >gi|768399706|ref|XP_011595740.1| PREDICTED: transmembrane protein 258 [Aquila chrysaetos canadensis] >gi|795168101|ref|XP_011798108.1| PREDICTED: transmembrane protein 258 [Colobus angolensis palliatus] >gi|795205448|ref|XP_011848736.1| PREDICTED: transmembrane protein 258 isoform X3 [Mandrillus leucophaeus] >gi|795504200|ref|XP_011897494.1| PREDICTED: transmembrane protein 258 [Cercocebus atys] >gi|795553903|ref|XP_011718715.1| PREDICTED: transmembrane protein 258 [Macaca nemestrina] >gi|817279390|ref|XP_012309820.1| transmembrane protein 258 [Aotus nancymaae] >gi|826345734|ref|XP_012518169.1| PREDICTED: transmembrane protein 258 [Propithecus coquereli] >gi|829833092|ref|XP_012633728.1| transmembrane protein 258 [Microcebus murinus] >gi|830032625|ref|XP_012580708.1| PREDICTED: transmembrane protein 258 [Condylura cristata] >gi|831220759|ref|XP_012658757.1| transmembrane protein 258 [Otolemur garnettii] >gi|837837653|ref|XP_004599380.2| PREDICTED: transmembrane protein 258 [Ochotona princeps] >gi|852733636|ref|XP_012864436.1| PREDICTED: transmembrane protein 258 [Dipodomys ordii] >gi|852786737|ref|XP_012884581.1| PREDICTED: transmembrane protein 258 [Dipodomys ordii] >gi|909809520|ref|XP_013159477.1| PREDICTED: transmembrane protein 258 [Falco peregrinus] >gi|909809522|ref|XP_005243406.2| PREDICTED: transmembrane protein 258 [Falco peregrinus] >gi|929519270|ref|XP_005496458.2| PREDICTED: transmembrane protein 258 [Zonotrichia albicollis] >gi|959062347|ref|XP_014734256.1| PREDICTED: transmembrane protein 258 [Sturnus vulgaris] >gi|961763603|ref|XP_014940680.1| PREDICTED: transmembrane protein 258 [Acinonyx jubatus] >gi|1003777000|ref|XP_015718722.1| PREDICTED: transmembrane protein 258 [Coturnix japonica] >gi|1008794364|ref|XP_015842797.1| PREDICTED: transmembrane protein 258 isoform X2 [Peromyscus maniculatus bairdii] >gi|1012271544|ref|XP_015983400.1| PREDICTED: transmembrane protein 258 [Rousettus aegyptiacus] >gi|1016656243|ref|XP_016055958.1| PREDICTED: transmembrane protein 258 [Miniopterus natalensis] >gi|1016659915|ref|XP_007526390.2| PREDICTED: transmembrane protein 258 [Erinaceus europaeus] >gi|1044415629|ref|XP_017359341.1| PREDICTED: transmembrane protein 258 [Cebus capucinus imitator] >gi|1048443854|ref|XP_017508086.1| PREDICTED: transmembrane protein 258 [Manis javanica] >gi|1051221862|ref|XP_017694426.1| PREDICTED: transmembrane protein 258 [Lepidothrix coronata] >gi|1059155125|ref|XP_017733910.1| PREDICTED: transmembrane protein 258 [Rhinopithecus bieti] >gi|1111188415|ref|XP_019270185.1| PREDICTED: transmembrane protein 258 [Panthera pardus] >gi|1117236360|ref|XP_019360530.1| PREDICTED: transmembrane protein 258 [Gavialis gangeticus] >gi|1121821994|ref|XP_019511477.1| PREDICTED: transmembrane protein 258 [Hipposideros armiger] >gi|1121889435|ref|XP_019402879.1| PREDICTED: transmembrane protein 258 [Crocodylus porosus] >gi|1124001816|ref|XP_019609584.1| PREDICTED: transmembrane protein 258 [Rhinolophus sinicus] >gi|1147246419|ref|XP_020018322.1| transmembrane protein 258 [Castor canadensis] >gi|1190440929|ref|XP_020823998.1| transmembrane protein 258 [Phascolarctos cinereus] >gi|1195496939|ref|XP_021069625.1| transmembrane protein 258 [Mus pahari] >gi|1201893992|ref|XP_021256881.1| transmembrane protein 258 isoform X2 [Numida meleagris] >gi|1209974807|ref|XP_021380407.1| transmembrane protein 258 [Lonchura striata domestica] >gi|1212181041|ref|XP_021540585.1| transmembrane protein 258 [Neomonachus schauinslandi] >gi|1244103971|ref|XP_022362715.1| transmembrane protein 258 [Enhydra lutris kenyoni] >gi|1244111879|ref|XP_022367014.1| LOW QUALITY PROTEIN: transmembrane protein 258-like [Enhydra lutris kenyoni] >gi|1246202638|ref|XP_022447511.1| transmembrane protein 258 [Delphinapterus leucas] >gi|1297719252|ref|XP_023045246.1| transmembrane protein 258 [Piliocolobus tephrosceles] >gi|1334076027|ref|XP_004646778.2| transmembrane protein 258 [Octodon degus] >gi|1334667567|ref|XP_023594070.1| transmembrane protein 258 [Trichechus manatus latirostris] >gi|1341012029|ref|XP_023784216.1| transmembrane protein 258 [Cyanistes caeruleus] >gi|1344889977|ref|XP_023966397.1| transmembrane protein 258 isoform X2 [Chrysemys picta bellii] >gi|1351521128|ref|XP_024053262.1| transmembrane protein 258 [Terrapene mexicana triunguis] >gi|47117653|sp|P61165.1|TM258_HUMAN RecName: Full=Transmembrane protein 258 >gi|47117654|sp|P61166.1|TM258_MOUSE RecName: Full=Transmembrane protein 258 >gi|82130508|sp|Q76LT9.1|TM258_CHICK RecName: Full=Transmembrane protein 258; AltName: Full=Protein NEF1 >gi|6808504|gb|AAF28401.1|AF086763_1 C11orf10 [Homo sapiens] >gi|4454698|gb|AAD20967.1| HSPC005 [Homo sapiens] >gi|12803819|gb|AAH02750.1| Chromosome 11 open reading frame 10 [Homo sapiens] >gi|12840843|dbj|BAB24978.1| unnamed protein product [Mus musculus] >gi|16359008|gb|AAH15968.1| Chromosome 11 open reading frame 10 [Homo sapiens] >gi|20330506|dbj|BAB91134.1| NEF1 [Gallus gallus] >gi|53133704|emb|CAG32181.1| hypothetical protein RCJMB04_19i7 [Gallus gallus] >gi|53791233|dbj|BAD52442.1| hypothetical protein [Mus musculus] >gi|74219080|dbj|BAE26683.1| unnamed protein product [Mus musculus] >gi|119594376|gb|EAW73970.1| chromosome 11 open reading frame 10, isoform CRA_a [Homo sapiens] >gi|148709398|gb|EDL41344.1| mCG1963, isoform CRA_b [Mus musculus] >gi|158256798|dbj|BAF84372.1| unnamed protein product [Homo sapiens] >gi|197129321|gb|ACH45819.1| putative nef1 variant 1 [Taeniopygia guttata] >gi|197129322|gb|ACH45820.1| putative nef1 variant 1 [Taeniopygia guttata] >gi|197129323|gb|ACH45821.1| putative nef1 variant 1 [Taeniopygia guttata] >gi|649098832|gb|AIC48390.1| C11orf10, partial [synthetic construct] >gi|1147700419|emb|SJX44670.1| unnamed protein product, partial [Human ORFeome Gateway entry vector] >gi|1159643175|gb|OPJ74140.1| transmembrane protein 258 [Patagioenas fasciata monilis] >gi|1208031005|gb|OWK57429.1| Transmembrane protein 258 [Lonchura striata domestica] >gi|1331785627|gb|PNI45243.1| TMEM258 isoform 2 [Pan troglodytes] >gi|1331785631|gb|PNI45247.1| TMEM258 isoform 6 [Pan troglodytes] >gi|1331873881|gb|PNJ22062.1| TMEM258 isoform 3 [Pongo abelii] >gi|1331873882|gb|PNJ22063.1| TMEM258 isoform 5 [Pongo abelii]) HSP 1 Score: 124.405 bits (311), Expect = 3.378e-31 Identity = 53/74 (71.62%), Postives = 65/74 (87.84%), Query Frame = 0 Query: 241 VSLDGYARYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 + L+ +RY SPVNPA++PHL VVLL IG+FFTAWFFVYEVTSTK+TR+I KE+LIS++AS+FMG G LFLLLW Sbjct: 1 MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLW 74
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. nr
Match: gi|950927940|ref|XP_006270611.2| (PREDICTED: transmembrane protein 258 [Alligator mississippiensis]) HSP 1 Score: 124.405 bits (311), Expect = 3.521e-31 Identity = 53/74 (71.62%), Postives = 65/74 (87.84%), Query Frame = 0 Query: 241 VSLDGYARYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 + L+ +RY SPVNPA++PHL VVLL IG+FFTAWFFVYEVTSTK+TR+I KE+LIS++AS+FMG G LFLLLW Sbjct: 1 MDLEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLW 74
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. nr
Match: gi|281345365|gb|EFB20949.1| (hypothetical protein PANDA_015900, partial [Ailuropoda melanoleuca] >gi|355566423|gb|EHH22802.1| hypothetical protein EGK_06133, partial [Macaca mulatta] >gi|355752044|gb|EHH56164.1| hypothetical protein EGM_05522, partial [Macaca fascicularis] >gi|431910393|gb|ELK13466.1| Protein NEF1, partial [Pteropus alecto] >gi|465969252|gb|EMP32022.1| Protein NEF1, partial [Chelonia mydas] >gi|678204992|gb|KFV71973.1| Transmembrane protein 258, partial [Struthio camelus australis]) HSP 1 Score: 124.02 bits (310), Expect = 3.998e-31 Identity = 53/72 (73.61%), Postives = 64/72 (88.89%), Query Frame = 0 Query: 243 LDGYARYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 L+ +RY SPVNPA++PHL VVLL IG+FFTAWFFVYEVTSTK+TR+I KE+LIS++AS+FMG G LFLLLW Sbjct: 2 LEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLW 73
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. nr
Match: gi|440901463|gb|ELR52398.1| (hypothetical protein M91_15481, partial [Bos mutus]) HSP 1 Score: 124.02 bits (310), Expect = 3.998e-31 Identity = 53/72 (73.61%), Postives = 64/72 (88.89%), Query Frame = 0 Query: 243 LDGYARYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 L+ +RY SPVNPA++PHL VVLL IG+FFTAWFFVYEVTSTK+TR+I KE+LIS++AS+FMG G LFLLLW Sbjct: 2 LEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLW 73
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. nr
Match: gi|119594377|gb|EAW73971.1| (chromosome 11 open reading frame 10, isoform CRA_b [Homo sapiens]) HSP 1 Score: 124.02 bits (310), Expect = 3.998e-31 Identity = 53/72 (73.61%), Postives = 64/72 (88.89%), Query Frame = 0 Query: 243 LDGYARYLSPVNPAMYPHLAVVLLIIGLFFTAWFFVYEVTSTKFTREIVKEILISMIASIFMGMGTLFLLLW 314 L+ +RY SPVNPA++PHL VVLL IG+FFTAWFFVYEVTSTK+TR+I KE+LIS++AS+FMG G LFLLLW Sbjct: 2 LEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLW 73 The following BLAST results are available for this feature:
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 7
BLAST of upf0197 transmembrane protein c11orf10 homolog vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold110_size354795:186984..197423+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold110_size354795-snap-gene-2.21 ID=maker-scaffold110_size354795-snap-gene-2.21|Name=upf0197 transmembrane protein c11orf10 homolog|organism=Tigriopus kingsejongensis|type=gene|length=10440bp|location=Sequence derived from alignment at scaffold110_size354795:186984..197423+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'upf0197 transmembrane protein c11orf10 homolog' has the following synonyms
Add to Basket
|