apoptosis regulator bcl-2-like, maker-scaffold115_size343722-snap-gene-2.18 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of apoptosis regulator bcl-2-like vs. nr
Match: gi|1325268151|ref|XP_023344648.1| (bcl-2-like protein 1 isoform X2 [Eurytemora affinis]) HSP 1 Score: 57.3806 bits (137), Expect = 7.242e-7 Identity = 27/74 (36.49%), Postives = 43/74 (58.11%), Query Frame = 0 Query: 105 LASETEKLAFDIVFYSIGRRKSAACDETTQCLRRSVQHMLDNHSLLFNGMIARLQLSTNSDLQRGFHELANELF 178 + ET +L V++S+ S + T CLRR + M + HS++F GM+ RL ++ N D +GF E++ ELF Sbjct: 33 IKQETRELVDFAVYFSLRTNFSGSSTRTESCLRRCISRMHEKHSMVFGGMMTRLNINRNIDFYQGFIEVSEELF 106 The following BLAST results are available for this feature:
BLAST of apoptosis regulator bcl-2-like vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 0
BLAST of apoptosis regulator bcl-2-like vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of apoptosis regulator bcl-2-like vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold115_size343722:316839..318358+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold115_size343722-snap-gene-2.18 ID=maker-scaffold115_size343722-snap-gene-2.18|Name=apoptosis regulator bcl-2-like|organism=Tigriopus kingsejongensis|type=gene|length=1520bp|location=Sequence derived from alignment at scaffold115_size343722:316839..318358+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'apoptosis regulator bcl-2-like' has the following synonyms
Add to Basket
|