small mechanosensitive ion channel protein, maker-scaffold146_size311726-snap-gene-2.18 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of small mechanosensitive ion channel protein vs. L. salmonis genes
Match: EMLSAG00000011277 (supercontig:LSalAtl2s:LSalAtl2s772:344077:345970:1 gene:EMLSAG00000011277 transcript:EMLSAT00000011277 description:"maker-LSalAtl2s772-augustus-gene-3.31") HSP 1 Score: 77.7962 bits (190), Expect = 1.424e-19 Identity = 45/122 (36.89%), Postives = 65/122 (53.28%), Query Frame = 0 Query: 12 PPTPSGTCAKYLRYGAVEMKPFQPGQRYRSRRDKEQSVRGYRAVSEGISATAAEIENQSRRHQSMERHGWTSVAFHNSTVGYTSERLAGNAWQHNYAYNRQAFPPIGRPGQPGLPHAYRYFG 133 P +PS T KY+RY + K F+PG YRS + E V GY+ + + A+ E++ QS+ S +R NS VGYTSER+ GN W+H++ + F + P P L +RY G Sbjct: 7 PQSPSLTAMKYMRYSSGTEK-FEPGVLYRSHMNMEAHVHGYKNLRREMRASTEEMDWQSKYRSSPDRIITPVCVLRNSIVGYTSERVCGNNWRHDFVPSSVRF-SVATPRNPYLTRTFRYMG 126
BLAST of small mechanosensitive ion channel protein vs. L. salmonis genes
Match: EMLSAG00000006077 (supercontig:LSalAtl2s:LSalAtl2s32:112309:112878:-1 gene:EMLSAG00000006077 transcript:EMLSAT00000006077 description:"maker-LSalAtl2s32-snap-gene-1.27") HSP 1 Score: 44.669 bits (104), Expect = 5.524e-7 Identity = 29/93 (31.18%), Postives = 48/93 (51.61%), Query Frame = 0 Query: 14 TPSGTCAKYLRY-GAVEMKPFQPGQRYRSRRDKEQSVRGYRAVSEGISATAAEIENQSRRHQSMERHGWTSVAFHNSTVGYTSERLAGNAWQH 105 PS T KYL + ++ + G YR++ D E+SVRGY+ V +GI +E+E + + M R W + ST G ++ +L + +H Sbjct: 14 VPSNTAYKYLHHTKVIDQEDVPVGASYRAKSDMEKSVRGYKEVQKGIQRRISEME----KLKXMNRIEWPII----STSGVSASKLNQSGQEH 98 The following BLAST results are available for this feature:
BLAST of small mechanosensitive ion channel protein vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 2
BLAST of small mechanosensitive ion channel protein vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of small mechanosensitive ion channel protein vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold146_size311726:219431..220047+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold146_size311726-snap-gene-2.18 ID=maker-scaffold146_size311726-snap-gene-2.18|Name=small mechanosensitive ion channel protein|organism=Tigriopus kingsejongensis|type=gene|length=617bp|location=Sequence derived from alignment at scaffold146_size311726:219431..220047+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'small mechanosensitive ion channel protein' has the following synonyms
Add to Basket
|