achain crystal structure of engineered northeast structural genomics consortium target, maker-scaffold147_size311475-snap-gene-2.16 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Match: gi|402550781|pdb|4GMR|A (Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. >gi|402550782|pdb|4GMR|B Chain B, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266.) HSP 1 Score: 63.5438 bits (153), Expect = 6.948e-9 Identity = 36/90 (40.00%), Postives = 50/90 (55.56%), Query Frame = 0 Query: 43 PLHRSAAIGRNDILKLLVDAGCDINAYSTHDHDRMTCLHIAVWCNQPETLKILLHMKADPNLSGTWMDCSG-TPLDFARQYKNNDMIAIF 131 PLH +A G +++KLL+ G D NA D D T LH+A E +K+LL ADPN S D G TPLD AR++ N +++ + Sbjct: 73 PLHLAAENGHKEVVKLLLSQGADPNAK---DSDGKTPLHLAAENGHKEVVKLLLSQGADPNTS----DSDGRTPLDLAREHGNEEVVKLL 155
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Match: gi|408536130|pdb|4HB5|A (Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. >gi|408536131|pdb|4HB5|B Chain B, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267.) HSP 1 Score: 62.003 bits (149), Expect = 2.795e-8 Identity = 37/90 (41.11%), Postives = 49/90 (54.44%), Query Frame = 0 Query: 43 PLHRSAAIGRNDILKLLVDAGCDINAYSTHDHDRMTCLHIAVWCNQPETLKILLHMKADPNLSGTWMDCSG-TPLDFARQYKNNDMIAIF 131 PLH +A G +I+KLL+ G D NA D D T LH A E +K+LL ADPN S D G TPLD AR++ N +++ + Sbjct: 73 PLHYAAENGHKEIVKLLLSKGADPNAK---DSDGRTPLHYAAENGHKEIVKLLLSKGADPNTS----DSDGRTPLDLAREHGNEEIVKLL 155
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Match: gi|1103700590|pdb|5EIL|A (Chain A, Computational Design Of A High-affinity Metalloprotein Homotrimer Containing A Metal Chelating Non-canonical Amino Acid >gi|1103700591|pdb|5EIL|B Chain B, Computational Design Of A High-affinity Metalloprotein Homotrimer Containing A Metal Chelating Non-canonical Amino Acid >gi|1103700592|pdb|5EIL|C Chain C, Computational Design Of A High-affinity Metalloprotein Homotrimer Containing A Metal Chelating Non-canonical Amino Acid) HSP 1 Score: 61.2326 bits (147), Expect = 4.995e-8 Identity = 37/90 (41.11%), Postives = 49/90 (54.44%), Query Frame = 0 Query: 43 PLHRSAAIGRNDILKLLVDAGCDINAYSTHDHDRMTCLHIAVWCNQPETLKILLHMKADPNLSGTWMDCSG-TPLDFARQYKNNDMIAIF 131 PLH +A G +I+KLL+ G D NA D D T LH A E +K+LL ADPN S D G TPLD AR++ N +++ + Sbjct: 73 PLHYAAENGHKEIVKLLLSKGADPNAK---DSDGRTPLHYAAENGHKEIVKLLLSKGADPNTS----DSDGRTPLDLAREHGNEEIVKLL 155
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Match: gi|414145861|pdb|4HQD|A (Chain A, Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR265. >gi|414145862|pdb|4HQD|B Chain B, Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR265.) HSP 1 Score: 60.077 bits (144), Expect = 1.451e-7 Identity = 35/90 (38.89%), Postives = 49/90 (54.44%), Query Frame = 0 Query: 43 PLHRSAAIGRNDILKLLVDAGCDINAYSTHDHDRMTCLHIAVWCNQPETLKILLHMKADPNLSGTWMDCSG-TPLDFARQYKNNDMIAIF 131 PLH +A G +I+KLL+ G D+NA D D T LH A E +K+L+ AD N S D G TPLD AR++ N +++ + Sbjct: 73 PLHYAAKEGHKEIVKLLISKGADVNAK---DSDGRTPLHYAAKEGHKEIVKLLISKGADVNTS----DSDGRTPLDLAREHGNEEIVKLL 155
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Match: gi|403072298|pdb|4GPM|A (Chain A, Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR264. >gi|403072299|pdb|4GPM|B Chain B, Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR264.) HSP 1 Score: 60.077 bits (144), Expect = 1.572e-7 Identity = 34/90 (37.78%), Postives = 49/90 (54.44%), Query Frame = 0 Query: 43 PLHRSAAIGRNDILKLLVDAGCDINAYSTHDHDRMTCLHIAVWCNQPETLKILLHMKADPNLSGTWMDCSG-TPLDFARQYKNNDMIAIF 131 PLH +A G +++KLL+ G D+NA D D T LH A E +K+L+ AD N S D G TPLD AR++ N +++ + Sbjct: 73 PLHHAAENGHKEVVKLLISKGADVNAK---DSDGRTPLHHAAENGHKEVVKLLISKGADVNTS----DSDGRTPLDLAREHGNEEVVKLL 155 The following BLAST results are available for this feature:
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 0
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 5
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold147_size311475:229067..234601+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold147_size311475-snap-gene-2.16 ID=maker-scaffold147_size311475-snap-gene-2.16|Name=achain crystal structure of engineered northeast structural genomics consortium target|organism=Tigriopus kingsejongensis|type=gene|length=5535bp|location=Sequence derived from alignment at scaffold147_size311475:229067..234601+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'achain crystal structure of engineered northeast structural genomics consortium target' has the following synonyms
Add to Basket
|