mucin-15 isoform x1, maker-scaffold149_size310270-snap-gene-0.10 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of mucin-15 isoform x1 vs. nr
Match: gi|1325294934|ref|XP_023330579.1| (hemicentin-2-like [Eurytemora affinis]) HSP 1 Score: 57.3806 bits (137), Expect = 4.511e-7 Identity = 38/82 (46.34%), Postives = 46/82 (56.10%), Query Frame = 0 Query: 20 ATLQRRQTEDPETERRRRIRNNFSRLSQEVTYAELTMPRNKGYAPMKARSTDSPIPLQQVQLQYSTGPRNPPPKPPPRYTAP 101 AT+ R +T D E +R R IR+N SRLSQEVTYAELT+PR KGY M R DS + V + + P P AP Sbjct: 617 ATIGRNRT-DVENDRGRGIRHNLSRLSQEVTYAELTLPRGKGYTQMH-RLDDSGVTYASVNCNSPSTLQGCPSPLPEDLRAP 696 The following BLAST results are available for this feature:
BLAST of mucin-15 isoform x1 vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 0
BLAST of mucin-15 isoform x1 vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of mucin-15 isoform x1 vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold149_size310270:37596..38781- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold149_size310270-snap-gene-0.10 ID=maker-scaffold149_size310270-snap-gene-0.10|Name=mucin-15 isoform x1|organism=Tigriopus kingsejongensis|type=gene|length=1186bp|location=Sequence derived from alignment at scaffold149_size310270:37596..38781- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'mucin-15 isoform x1' has the following synonyms
Add to Basket
|