26s proteasome complex subunit dss1-like, maker-scaffold1518_size37722-snap-gene-0.18 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of 26s proteasome complex subunit dss1-like vs. L. salmonis genes
Match: EMLSAG00000005643 (supercontig:LSalAtl2s:LSalAtl2s303:371782:375196:1 gene:EMLSAG00000005643 transcript:EMLSAT00000005643 description:"augustus_masked-LSalAtl2s303-processed-gene-3.5") HSP 1 Score: 84.3445 bits (207), Expect = 5.607e-23 Identity = 38/49 (77.55%), Postives = 44/49 (89.80%), Query Frame = 0 Query: 25 DLGLLEEDDDFEEFPAEDWEAPDEDKADVNVWEDNWDDDTVEDDFSIQL 73 DLGLLE+DD+FEEFP E+W+ EDK D+NVWEDNWDDDTVEDDFS+QL Sbjct: 13 DLGLLEDDDEFEEFPHENWDESQEDKGDINVWEDNWDDDTVEDDFSVQL 61
BLAST of 26s proteasome complex subunit dss1-like vs. SwissProt
Match: gi|46397408|sp|P60896.1|SEM1_HUMAN (RecName: Full=26S proteasome complex subunit SEM1; AltName: Full=26S proteasome complex subunit DSS1; AltName: Full=Deleted in split hand/split foot protein 1; AltName: Full=Split hand/foot deleted protein 1; AltName: Full=Split hand/foot malformation type 1 protein >gi|46397409|sp|P60897.1|SEM1_MOUSE RecName: Full=26S proteasome complex subunit SEM1; AltName: Full=26S proteasome complex subunit DSS1; AltName: Full=Deleted in split hand/split foot protein 1 homolog; AltName: Full=Split hand/foot deleted protein 1 homolog; AltName: Full=Split hand/foot malformation type 1 protein homolog >gi|115502151|sp|Q3ZBR6.1|SEM1_BOVIN RecName: Full=26S proteasome complex subunit SEM1; AltName: Full=26S proteasome complex subunit DSS1; AltName: Full=Split hand/foot malformation type 1 protein homolog) HSP 1 Score: 64.6994 bits (156), Expect = 1.618e-14 Identity = 47/66 (71.21%), Postives = 52/66 (78.79%), Query Frame = 0 Query: 21 KETPDLGLLEEDDDFEEFPAEDWEAPDEDKADVNVWEDNWDDDTVEDDFSIQLRAELVNQGVNMES 86 K+ DLGLLEEDD+FEEFPAEDW DED+ D +VWEDNWDDD VEDDFS QLRAEL G ME+ Sbjct: 5 KQPVDLGLLEEDDEFEEFPAEDWAGLDEDE-DAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMET 69
BLAST of 26s proteasome complex subunit dss1-like vs. SwissProt
Match: gi|50401703|sp|Q9VM46.1|SEM1_DROME (RecName: Full=Probable 26S proteasome complex subunit sem1) HSP 1 Score: 50.8322 bits (120), Expect = 5.597e-9 Identity = 39/56 (69.64%), Postives = 47/56 (83.93%), Query Frame = 0 Query: 22 ETPDLGLLEEDDDFEEFPAEDWEAPDEDKADVNVWEDNWDDDTVEDDFSIQLRAEL 77 ++ DLGLLEEDD+FEEFPAED+ D D+ ++NVWEDNWDDD VEDDFS QL+A L Sbjct: 18 KSEDLGLLEEDDEFEEFPAEDFRVGD-DEEELNVWEDNWDDDNVEDDFSQQLKAHL 72
BLAST of 26s proteasome complex subunit dss1-like vs. SwissProt
Match: gi|50401649|sp|Q95Y72.2|DSS1_CAEEL (RecName: Full=Probable 26S proteasome complex subunit dss-1; AltName: Full=Deleted in split hand/split foot protein 1 homolog) HSP 1 Score: 49.6766 bits (117), Expect = 2.134e-8 Identity = 37/81 (45.68%), Postives = 54/81 (66.67%), Query Frame = 0 Query: 2 STASQKEGKASAAPADKAVKETPDLGLLEEDDDFEEFPAEDW-EAPDEDKADVNVWEDNWDDDTVEDDFSIQLRAELVNQG 81 STA++K+ K+SA P V++ E+++FEEFP ++W E + ++ DVNVWEDNWDD+T E +FS QL+ EL G Sbjct: 3 STAAKKDVKSSAVPVTAVVEKK-----EFEEEEFEEFPVQEWAERAEGEEDDVNVWEDNWDDETHESEFSKQLKEELRKSG 78
BLAST of 26s proteasome complex subunit dss1-like vs. SwissProt
Match: gi|50401355|sp|O94742.1|SEM1_YEAST (RecName: Full=26S proteasome complex subunit SEM1) HSP 1 Score: 49.6766 bits (117), Expect = 2.339e-8 Identity = 26/53 (49.06%), Postives = 38/53 (71.70%), Query Frame = 0 Query: 29 LEEDDDFEEFPAEDWEAPDEDKAD----VNVWEDNWDDDTVEDDFSIQLRAEL 77 LEEDD+FE+FP + W + K++ N+WE+NWDD V+DDF+ +L+AEL Sbjct: 29 LEEDDEFEDFPIDTWANGETIKSNAVTQTNIWEENWDDVEVDDDFTNELKAEL 81
BLAST of 26s proteasome complex subunit dss1-like vs. SwissProt
Match: gi|50401503|sp|Q7SA04.1|SEM1_NEUCR (RecName: Full=Putative 26S proteasome complex subunit sem-1) HSP 1 Score: 47.3654 bits (111), Expect = 2.012e-7 Identity = 35/81 (43.21%), Postives = 50/81 (61.73%), Query Frame = 0 Query: 2 STASQKEGKASAAPADKAVKETPDLGLLEEDDDFEEFPAEDWEAPDEDKADVN-----VWEDNWDDDTVEDDFSIQLRAEL 77 ST + + K++ ++ V E +LEEDD+FE+FP +DWEA D + A N +WE++WDDD DDFS QL+ EL Sbjct: 3 STQPKNDAKSTEPKPEQPVTEK-KTAVLEEDDEFEDFPVDDWEAEDTEAAKGNNEAKHLWEESWDDDDTSDDFSAQLKEEL 82
BLAST of 26s proteasome complex subunit dss1-like vs. nr
Match: gi|562858186|ref|XP_006157569.1| (PREDICTED: 26S proteasome complex subunit DSS1 [Tupaia chinensis]) HSP 1 Score: 86.6557 bits (213), Expect = 1.167e-20 Identity = 47/66 (71.21%), Postives = 51/66 (77.27%), Query Frame = 0 Query: 21 KETPDLGLLEEDDDFEEFPAEDWEAPDEDKADVNVWEDNWDDDTVEDDFSIQLRAELVNQGVNMES 86 K+ DLGLLEEDD FEEFPAEDW DED+ D +VWEDNWDDD VEDDFS QLRAEL G ME+ Sbjct: 5 KQPVDLGLLEEDDAFEEFPAEDWTGLDEDE-DAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMET 69
BLAST of 26s proteasome complex subunit dss1-like vs. nr
Match: gi|555968386|ref|XP_005896228.1| (PREDICTED: 26S proteasome complex subunit DSS1 [Bos mutus] >gi|440905733|gb|ELR56078.1| 26S proteasome complex subunit DSS1 [Bos mutus]) HSP 1 Score: 83.1889 bits (204), Expect = 2.800e-19 Identity = 45/66 (68.18%), Postives = 51/66 (77.27%), Query Frame = 0 Query: 21 KETPDLGLLEEDDDFEEFPAEDWEAPDEDKADVNVWEDNWDDDTVEDDFSIQLRAELVNQGVNMES 86 K+ DL LLE+DD+FEEFPAEDW DED+ D +VWEDNWDDD VEDDFS QLRAEL G ME+ Sbjct: 5 KQPVDLCLLEDDDEFEEFPAEDWAGLDEDE-DAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMET 69
BLAST of 26s proteasome complex subunit dss1-like vs. nr
Match: gi|1032914166|ref|XP_007648433.2| (PREDICTED: LOW QUALITY PROTEIN: 26S proteasome complex subunit DSS1 [Cricetulus griseus] >gi|1032944719|ref|XP_007621514.2| PREDICTED: LOW QUALITY PROTEIN: 26S proteasome complex subunit DSS1 [Cricetulus griseus]) HSP 1 Score: 82.4185 bits (202), Expect = 4.790e-19 Identity = 44/67 (65.67%), Postives = 51/67 (76.12%), Query Frame = 0 Query: 20 VKETPDLGLLEEDDDFEEFPAEDWEAPDEDKADVNVWEDNWDDDTVEDDFSIQLRAELVNQGVNMES 86 +K+ DLGLLEE D+F+EFP EDW DED+ D VWEDNWDDD+VEDDFS QLRAEL G ME+ Sbjct: 4 MKQPVDLGLLEEGDEFKEFPXEDWAGLDEDE-DARVWEDNWDDDSVEDDFSNQLRAELEKHGYKMET 69
BLAST of 26s proteasome complex subunit dss1-like vs. nr
Match: gi|942030317|ref|XP_014332563.1| (PREDICTED: 26S proteasome complex subunit DSS1 [Bos mutus]) HSP 1 Score: 80.1073 bits (196), Expect = 4.245e-18 Identity = 46/69 (66.67%), Postives = 52/69 (75.36%), Query Frame = 0 Query: 21 KETPDLGLLEEDDDFEEFPAEDWE---APDEDKADVNVWEDNWDDDTVEDDFSIQLRAELVNQGVNMES 86 K+ DLGLLE+DD+FEEFPAEDW DED+ D +VWEDNWDDD VEDDFS QLRAEL G ME+ Sbjct: 5 KQPVDLGLLEDDDEFEEFPAEDWADWAGLDEDE-DAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMET 72
BLAST of 26s proteasome complex subunit dss1-like vs. nr
Match: gi|1242739419|ref|XP_022326036.1| (26S proteasome complex subunit SEM1-like [Crassostrea virginica]) HSP 1 Score: 78.1814 bits (191), Expect = 2.898e-17 Identity = 51/69 (73.91%), Postives = 57/69 (82.61%), Query Frame = 0 Query: 18 KAVKETPDLGLLEEDDDFEEFPAEDWEAPDEDKADVNVWEDNWDDDTVEDDFSIQLRAELVNQGVNMES 86 K ++ PDLGLLEEDD+FEEFPAEDW DED+ DVNVWEDNWDDD VEDDFS+QLRAEL QG +ME Sbjct: 5 KEKEKKPDLGLLEEDDEFEEFPAEDWTGADEDEEDVNVWEDNWDDDNVEDDFSLQLRAELEKQGKSMEG 73
BLAST of 26s proteasome complex subunit dss1-like vs. nr
Match: gi|762163374|ref|XP_011419976.1| (PREDICTED: 26S proteasome complex subunit DSS1-like [Crassostrea gigas]) HSP 1 Score: 76.2554 bits (186), Expect = 1.687e-16 Identity = 50/69 (72.46%), Postives = 56/69 (81.16%), Query Frame = 0 Query: 18 KAVKETPDLGLLEEDDDFEEFPAEDWEAPDEDKADVNVWEDNWDDDTVEDDFSIQLRAELVNQGVNMES 86 K ++ PDLGLLEEDD+FEEFPAEDW DED+ DVNVWEDNWDDD VEDDFS+QLRAEL QG +E Sbjct: 5 KEKEKKPDLGLLEEDDEFEEFPAEDWTGADEDEEDVNVWEDNWDDDNVEDDFSLQLRAELEKQGKTIEG 73
BLAST of 26s proteasome complex subunit dss1-like vs. nr
Match: gi|562858202|ref|XP_006157577.1| (PREDICTED: 26S proteasome complex subunit DSS1-like [Tupaia chinensis]) HSP 1 Score: 74.3294 bits (181), Expect = 1.742e-15 Identity = 38/54 (70.37%), Postives = 42/54 (77.78%), Query Frame = 0 Query: 33 DDFEEFPAEDWEAPDEDKADVNVWEDNWDDDTVEDDFSIQLRAELVNQGVNMES 86 D+FEEFPAEDW DED+ D +VWEDNWDDD VEDDFS QLRAEL G ME+ Sbjct: 45 DEFEEFPAEDWAGLDEDE-DAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMET 97
BLAST of 26s proteasome complex subunit dss1-like vs. nr
Match: gi|961097375|ref|XP_014774215.1| (PREDICTED: 26S proteasome complex subunit DSS1-like [Octopus bimaculoides] >gi|918316798|gb|KOF86044.1| hypothetical protein OCBIM_22019323mg [Octopus bimaculoides]) HSP 1 Score: 73.559 bits (179), Expect = 1.809e-15 Identity = 44/62 (70.97%), Postives = 53/62 (85.48%), Query Frame = 0 Query: 24 PDLGLLEEDDDFEEFPAEDWEAPDEDKADVNVWEDNWDDDTVEDDFSIQLRAELVNQGVNME 85 PDLG+LEEDD+FEEFPAEDW +E+K D+NVWEDNWDDD +EDDFS QLRA+L QG ++E Sbjct: 8 PDLGILEEDDEFEEFPAEDWNGAEEEKNDINVWEDNWDDDNIEDDFSKQLRAQLELQGKSLE 69
BLAST of 26s proteasome complex subunit dss1-like vs. nr
Match: gi|646722118|gb|KDR23221.1| (26S proteasome complex subunit DSS1 [Zootermopsis nevadensis]) HSP 1 Score: 73.559 bits (179), Expect = 1.860e-15 Identity = 50/71 (70.42%), Postives = 57/71 (80.28%), Query Frame = 0 Query: 16 ADKAVKETPDLGLLEEDDDFEEFPAEDWEAPDEDKADVNVWEDNWDDDTVEDDFSIQLRAELVNQGVNMES 86 D A K DLGLLEEDD+FEEFPAEDW DED+ D++VWEDNWDDD VEDDFS+QLRAEL QGV ++S Sbjct: 2 TDSANKPKVDLGLLEEDDEFEEFPAEDWAGKDEDEEDISVWEDNWDDDNVEDDFSMQLRAELEKQGVKVDS 72
BLAST of 26s proteasome complex subunit dss1-like vs. nr
Match: gi|1330887478|gb|PNF20791.1| (26S proteasome complex subunit SEM1 [Cryptotermes secundus]) HSP 1 Score: 73.1738 bits (178), Expect = 2.444e-15 Identity = 48/66 (72.73%), Postives = 55/66 (83.33%), Query Frame = 0 Query: 21 KETPDLGLLEEDDDFEEFPAEDWEAPDEDKADVNVWEDNWDDDTVEDDFSIQLRAELVNQGVNMES 86 K DLGLLEEDD+FEEFPAEDW DED+ D++VWEDNWDDD VEDDFS+QLRAEL QGV ++S Sbjct: 4 KPKVDLGLLEEDDEFEEFPAEDWTGKDEDEGDISVWEDNWDDDNVEDDFSMQLRAELEKQGVKLDS 69 The following BLAST results are available for this feature:
BLAST of 26s proteasome complex subunit dss1-like vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of 26s proteasome complex subunit dss1-like vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 5
BLAST of 26s proteasome complex subunit dss1-like vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold1518_size37722:27434..28882- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold1518_size37722-snap-gene-0.18 ID=maker-scaffold1518_size37722-snap-gene-0.18|Name=26s proteasome complex subunit dss1-like|organism=Tigriopus kingsejongensis|type=gene|length=1449bp|location=Sequence derived from alignment at scaffold1518_size37722:27434..28882- (Tigriopus kingsejongensis)back to top Synonyms
The feature '26s proteasome complex subunit dss1-like' has the following synonyms
Add to Basket
|