trna -lysidine synthetase, maker-scaffold187_size272365-snap-gene-1.26 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of trna -lysidine synthetase vs. L. salmonis genes
Match: EMLSAG00000011585 (supercontig:LSalAtl2s:LSalAtl2s800:232205:240525:1 gene:EMLSAG00000011585 transcript:EMLSAT00000011585 description:"maker-LSalAtl2s800-augustus-gene-2.32") HSP 1 Score: 69.3218 bits (168), Expect = 9.874e-16 Identity = 44/90 (48.89%), Postives = 57/90 (63.33%), Query Frame = 0 Query: 21 SLKWNMAMIKLLLAMK-KGDQDQEV-EDELLVNNEIPMKLKEAEITTAPKAQGPVICKMKPFNICYRINPQGQSVHTGGNRRPVRLLRVY 108 S ++N+AMI LLAMK KG + EV D+ LV E+ LK + T Q P+ICK P+NICY+I+ G +H GN RPVR+LRVY Sbjct: 119 SAEFNLAMINYLLAMKAKGHKINEVNSDKPLV--ELHKDLKATKATDG-NLQDPLICKTAPYNICYKIDKYG-ILHPLGNHRPVRILRVY 204
BLAST of trna -lysidine synthetase vs. L. salmonis genes
Match: EMLSAG00000000978 (supercontig:LSalAtl2s:LSalAtl2s116:1659443:1676803:1 gene:EMLSAG00000000978 transcript:EMLSAT00000000978 description:"maker-LSalAtl2s116-augustus-gene-16.10") HSP 1 Score: 47.7506 bits (112), Expect = 8.697e-8 Identity = 26/91 (28.57%), Postives = 46/91 (50.55%), Query Frame = 0 Query: 18 EKHSLKWNMAMIKLLLAMKKGDQDQEVEDELLVNNEIPMKLKEAEITTAPKAQGPVICKMKPFNICYRINPQGQSVHTGGNRRPVRLLRVY 108 EK W+ +++L MK+ + +V + + + +P + VICKM+P+N CY + P G + + +RP+RLLR+Y Sbjct: 121 EKSDSNWSPDFVEMLQNMKEEGRSIKVNSDQ----------DDMNLVQSPNS---VICKMEPYNTCYHVAPNGDILLSLVRQRPMRLLRIY 198 The following BLAST results are available for this feature:
BLAST of trna -lysidine synthetase vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 2
BLAST of trna -lysidine synthetase vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of trna -lysidine synthetase vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold187_size272365:159054..159593+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold187_size272365-snap-gene-1.26 ID=maker-scaffold187_size272365-snap-gene-1.26|Name=trna -lysidine synthetase|organism=Tigriopus kingsejongensis|type=gene|length=540bp|location=Sequence derived from alignment at scaffold187_size272365:159054..159593+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'trna -lysidine synthetase' has the following synonyms
Add to Basket
|