upf0184 protein c9orf16 homolog, maker-scaffold2199_size18937-snap-gene-0.3 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of upf0184 protein c9orf16 homolog vs. SwissProt
Match: gi|122136471|sp|Q2NKS9.1|CI016_BOVIN (RecName: Full=UPF0184 protein C9orf16 homolog) HSP 1 Score: 51.6026 bits (122), Expect = 2.672e-8 Identity = 23/51 (45.10%), Postives = 37/51 (72.55%), Query Frame = 0 Query: 94 EAEEEDFDQAAYAALDRQLDALDRALDNIEERNDNLHGQLKGLLETDPPGR 144 E EE+ F +A YAA++ LD ++ LD++EE+ND+LH +L+ LLE++ R Sbjct: 17 EGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTR 67
BLAST of upf0184 protein c9orf16 homolog vs. SwissProt
Match: gi|20137930|sp|Q9BUW7.1|CI016_HUMAN (RecName: Full=UPF0184 protein C9orf16) HSP 1 Score: 51.2174 bits (121), Expect = 3.097e-8 Identity = 23/51 (45.10%), Postives = 37/51 (72.55%), Query Frame = 0 Query: 94 EAEEEDFDQAAYAALDRQLDALDRALDNIEERNDNLHGQLKGLLETDPPGR 144 E EE+ F +A YAA++ LD ++ LD++EE+ND+LH +L+ LLE++ R Sbjct: 17 EGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTR 67
BLAST of upf0184 protein c9orf16 homolog vs. SwissProt
Match: gi|20137739|sp|P58686.1|CI016_MOUSE (RecName: Full=UPF0184 protein C9orf16 homolog) HSP 1 Score: 49.6766 bits (117), Expect = 1.442e-7 Identity = 22/51 (43.14%), Postives = 36/51 (70.59%), Query Frame = 0 Query: 94 EAEEEDFDQAAYAALDRQLDALDRALDNIEERNDNLHGQLKGLLETDPPGR 144 E E + F +A YAA++ LD ++ LD++EE+ND+LH +L+ LLE++ R Sbjct: 17 EGENDSFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTR 67 The following BLAST results are available for this feature:
BLAST of upf0184 protein c9orf16 homolog vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 0
BLAST of upf0184 protein c9orf16 homolog vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 3
BLAST of upf0184 protein c9orf16 homolog vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold2199_size18937:18007..18667- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold2199_size18937-snap-gene-0.3 ID=maker-scaffold2199_size18937-snap-gene-0.3|Name=upf0184 protein c9orf16 homolog|organism=Tigriopus kingsejongensis|type=gene|length=661bp|location=Sequence derived from alignment at scaffold2199_size18937:18007..18667- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'upf0184 protein c9orf16 homolog' has the following synonyms
Add to Basket
|