u4 small nuclear ribonucleoprotein 27 kda protein, maker-scaffold308_size214241-snap-gene-1.48 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of u4 small nuclear ribonucleoprotein 27 kda protein vs. L. salmonis genes
Match: EMLSAG00000004178 (supercontig:LSalAtl2s:LSalAtl2s220:73548:73982:1 gene:EMLSAG00000004178 transcript:EMLSAT00000004178 description:"augustus_masked-LSalAtl2s220-processed-gene-0.2") HSP 1 Score: 48.1358 bits (113), Expect = 1.620e-7 Identity = 31/74 (41.89%), Postives = 45/74 (60.81%), Query Frame = 0 Query: 75 RRSRSPLDRKADREKNWDEEREKRKRELRDESFMMVATTEIP--NEHLEGKTPEEIEMMRVMGFAGFTTTKGKK 146 R+ SP D WD EREK+K+E + +S ++ + IP + + GKT EE+EM++ MGFA F T+K KK Sbjct: 36 HRAESPPRTPVDESAAWDREREKKKKEKQHQSLVLASQHPIPFSEKEMAGKTQEELEMIKTMGFASFDTSKNKK 109
BLAST of u4 small nuclear ribonucleoprotein 27 kda protein vs. SwissProt
Match: gi|74760570|sp|Q8WVK2.1|SNR27_HUMAN (RecName: Full=U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein; Short=U4/U6.U5 snRNP 27 kDa protein; Short=U4/U6.U5-27K; AltName: Full=Nucleic acid-binding protein RY-1; AltName: Full=U4/U6.U5 tri-snRNP-associated 27 kDa protein; Short=27K; AltName: Full=U4/U6.U5 tri-snRNP-associated protein 3) HSP 1 Score: 51.9878 bits (123), Expect = 2.390e-7 Identity = 27/53 (50.94%), Postives = 34/53 (64.15%), Query Frame = 0 Query: 114 EIPNEHLEGKTPEEIEMMRVMGFAGFTTTKGKKSDRAPLLLGRVEGTAGALAL 166 +I E LEGKT EEIEMM++MGFA F +TKGKK V+G+ A A+ Sbjct: 87 QITEEDLEGKTEEEIEMMKLMGFASFDSTKGKK----------VDGSVNAYAI 129
BLAST of u4 small nuclear ribonucleoprotein 27 kda protein vs. SwissProt
Match: gi|81900912|sp|Q8K194.1|SNR27_MOUSE (RecName: Full=U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein; Short=U4/U6.U5 snRNP 27 kDa protein; Short=U4/U6.U5-27K; AltName: Full=U4/U6.U5 tri-snRNP-associated protein 3) HSP 1 Score: 51.9878 bits (123), Expect = 2.390e-7 Identity = 27/53 (50.94%), Postives = 34/53 (64.15%), Query Frame = 0 Query: 114 EIPNEHLEGKTPEEIEMMRVMGFAGFTTTKGKKSDRAPLLLGRVEGTAGALAL 166 +I E LEGKT EEIEMM++MGFA F +TKGKK V+G+ A A+ Sbjct: 87 QITEEDLEGKTEEEIEMMKLMGFASFDSTKGKK----------VDGSVNAYAI 129 The following BLAST results are available for this feature:
BLAST of u4 small nuclear ribonucleoprotein 27 kda protein vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of u4 small nuclear ribonucleoprotein 27 kda protein vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 2
BLAST of u4 small nuclear ribonucleoprotein 27 kda protein vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold308_size214241:160348..162081- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold308_size214241-snap-gene-1.48 ID=maker-scaffold308_size214241-snap-gene-1.48|Name=u4 small nuclear ribonucleoprotein 27 kda protein|organism=Tigriopus kingsejongensis|type=gene|length=1734bp|location=Sequence derived from alignment at scaffold308_size214241:160348..162081- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'u4 small nuclear ribonucleoprotein 27 kda protein' has the following synonyms
Add to Basket
|