triple functional domain, maker-scaffold356_size197960-snap-gene-0.34 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of triple functional domain vs. L. salmonis genes
Match: EMLSAG00000010458 (supercontig:LSalAtl2s:LSalAtl2s693:62511:68012:-1 gene:EMLSAG00000010458 transcript:EMLSAT00000010458 description:"maker-LSalAtl2s693-snap-gene-1.28") HSP 1 Score: 67.0106 bits (162), Expect = 3.249e-14 Identity = 49/149 (32.89%), Postives = 74/149 (49.66%), Query Frame = 0 Query: 1 LLLKRGTVECFKRKS-NLKKPKVKPCHFFVFQETIIICENS---QPVHDPTSPQSLDFVASFKMNKVIVREFNKGDSSFGFELERQM----------ERCSKSRE--SAREDSSIVVQCDTEEQRDEWLKIINDQIRELKDMARKLENP 133 LLLKRG VEC ++ K K K CH F+FQE+I+IC + + V+ T P+ L + + MNK+I+ E D + FEL+ + E+ + E + D I+ +C+ EE R+ W + N L + A L NP Sbjct: 294 LLLKRGVVECAEKTPIGQKNWKYKKCHIFLFQESIVICTDEDKYKEVNVNTIPE-LKYWHHYPMNKLIIAEI--SDENNTFELKNDLTDLRNEDDDNEKYDDTDEVDNKENDHCIIFKCEDEESRNSWYREFNLHKSYLSNFADALSNP 439
BLAST of triple functional domain vs. L. salmonis genes
Match: EMLSAG00000002417 (supercontig:LSalAtl2s:LSalAtl2s145:455239:514648:-1 gene:EMLSAG00000002417 transcript:EMLSAT00000002417 description:"augustus_masked-LSalAtl2s145-processed-gene-5.0") HSP 1 Score: 52.7582 bits (125), Expect = 3.128e-9 Identity = 42/142 (29.58%), Postives = 64/142 (45.07%), Query Frame = 0 Query: 2 LLKRGTVECFKRKSNLKKP-------KVKPCHFFVFQETIIICENSQPVHDPTSPQSLDFVASFKMNKVIVREFNKGDSSFGFELERQMERCSKSRESAREDSSIVVQCDTEEQRDEWLKIINDQIRELKDMARKLENPQFY 136 LL RG + C S P K+KP F+F++ +I E TSP + +VA F +NK+ + E F + +S + AR+ +I+ Q D E RD+W+ II Q++ D R L+ P Y Sbjct: 2201 LLYRGPLSCLDNFSGGPIPNGGGSTAKMKPFTVFLFEQIMIFSETVGKKTQFTSPVYV-YVAHFLVNKMSLEENVDDGHPCKFMI--------RSTDPARDALNIMCQTDEPESRDKWISIIKKQLQTQMDFLRALQAPIAY 2333 The following BLAST results are available for this feature:
BLAST of triple functional domain vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 2
BLAST of triple functional domain vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of triple functional domain vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold356_size197960:131770..132374- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold356_size197960-snap-gene-0.34 ID=maker-scaffold356_size197960-snap-gene-0.34|Name=triple functional domain|organism=Tigriopus kingsejongensis|type=gene|length=605bp|location=Sequence derived from alignment at scaffold356_size197960:131770..132374- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'triple functional domain' has the following synonyms
Add to Basket
|