---NA---, maker-scaffold388_size188554-snap-gene-0.21 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of ---NA--- vs. nr
Match: gi|1325282943|ref|XP_023326172.1| (uncharacterized protein LOC111699679 [Eurytemora affinis]) HSP 1 Score: 85.5001 bits (210), Expect = 8.808e-18 Identity = 46/105 (43.81%), Postives = 68/105 (64.76%), Query Frame = 0 Query: 39 VILILLAISGSSHGQGRRRQNFNEVQSGPPESKNLN----DRRNIGTEFPYRRGETPIFNFDQGDEVFLDTIPQLVKGLHQMAQVVGEQRKLTQAFGEAFAQCGS 139 VIL L + Q RR+ +F+E E +++N + +++G FP+ RG+TP+F+FDQGDE F+ TIP L++GL ++ +V QRK+TQAFGE F QC S Sbjct: 33 VILALSFLVLLVQSQRRRKPDFDE-----DEERDMNGVGRNYKDVGV-FPFPRGDTPVFHFDQGDEGFIKTIPDLIEGLDKIRGIVNTQRKITQAFGEGFDQCES 131 The following BLAST results are available for this feature:
BLAST of ---NA--- vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 0
BLAST of ---NA--- vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of ---NA--- vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold388_size188554:25621..27927- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold388_size188554-snap-gene-0.21 ID=maker-scaffold388_size188554-snap-gene-0.21|Name=---NA---|organism=Tigriopus kingsejongensis|type=gene|length=2307bp|location=Sequence derived from alignment at scaffold388_size188554:25621..27927- (Tigriopus kingsejongensis)back to top Synonyms
The feature '---NA---' has the following synonyms
Add to Basket
|