cytochrome c oxidase, maker-scaffold3945_size7060-snap-gene-0.0 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of cytochrome c oxidase vs. SwissProt
Match: gi|1352177|sp|P98000.1|COXN_BRADU (RecName: Full=Alternative cytochrome c oxidase subunit 1; AltName: Full=Alternative cytochrome c oxidase polypeptide I; AltName: Full=Cytochrome BB3 subunit 1; AltName: Full=Oxidase BB(3) subunit 1) HSP 1 Score: 58.9214 bits (141), Expect = 2.811e-9 Identity = 28/53 (52.83%), Postives = 38/53 (71.70%), Query Frame = 0 Query: 26 MDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 +DA+ YL +T+HG IMV ++LTA G F N LIPL +GARDM ++NM+S Sbjct: 76 IDANQYLQFITMHGMIMVIYLLTALFLGGFGNYLIPLMVGARDMVFPYVNMLS 128
BLAST of cytochrome c oxidase vs. nr
Match: gi|1119326133|ref|WP_072303473.1| (cytochrome c oxidase subunit I [Cellulophaga fucicola] >gi|1102059578|emb|SFW46128.1| cytochrome c oxidase subunit 1 [Cellulophaga fucicola]) HSP 1 Score: 154.836 bits (390), Expect = 1.087e-40 Identity = 73/78 (93.59%), Postives = 77/78 (98.72%), Query Frame = 0 Query: 1 MQLAWPGEAFPIFEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 MQLAWPGE+FP+FEA+LGKWAPGGVMDADVYLALVT+HGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASG LNMIS Sbjct: 56 MQLAWPGESFPVFEALLGKWAPGGVMDADVYLALVTMHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGLLNMIS 133
BLAST of cytochrome c oxidase vs. nr
Match: gi|652740681|ref|WP_027064970.1| (MULTISPECIES: cytochrome-c oxidase [Maribacter] >gi|1097826589|emb|SFR63373.1| cytochrome c oxidase subunit 1 [Maribacter stanieri]) HSP 1 Score: 154.836 bits (390), Expect = 1.097e-40 Identity = 72/78 (92.31%), Postives = 77/78 (98.72%), Query Frame = 0 Query: 1 MQLAWPGEAFPIFEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 MQLAWPGE+FPIFE +LGKWAPGGVMDAD+YLALVT+HGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNM+S Sbjct: 63 MQLAWPGESFPIFETLLGKWAPGGVMDADIYLALVTMHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMVS 140
BLAST of cytochrome c oxidase vs. nr
Match: gi|1011136360|ref|WP_062058100.1| (cytochrome c oxidase subunit I [Sediminicola sp. YIK13] >gi|946528912|gb|ALM08903.1| cytochrome C oxidase [Sediminicola sp. YIK13]) HSP 1 Score: 154.836 bits (390), Expect = 1.143e-40 Identity = 75/78 (96.15%), Postives = 77/78 (98.72%), Query Frame = 0 Query: 1 MQLAWPGEAFPIFEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 MQLAWPGE+FPIFEA+LGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASG LNMIS Sbjct: 63 MQLAWPGESFPIFEALLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGLLNMIS 140
BLAST of cytochrome c oxidase vs. nr
Match: gi|955657601|ref|WP_058103945.1| (MULTISPECIES: cytochrome c oxidase subunit I [Maribacter] >gi|955403110|gb|KSA15066.1| Sulfatase, family S1-28 [Maribacter dokdonensis DSW-8] >gi|1085850905|emb|SDT11487.1| cytochrome c oxidase subunit 1 [Maribacter sp. MAR_2009_60] >gi|1089013967|emb|SEB86488.1| cytochrome c oxidase subunit 1 [Maribacter dokdonensis] >gi|1098500734|gb|APA64813.1| cytochrome C oxidase [Maribacter sp. 1_2014MBL_MicDiv] >gi|1269373263|gb|PHN94425.1| cytochrome c oxidase subunit I [Maribacter sp. 6B07]) HSP 1 Score: 154.836 bits (390), Expect = 1.227e-40 Identity = 72/78 (92.31%), Postives = 77/78 (98.72%), Query Frame = 0 Query: 1 MQLAWPGEAFPIFEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 MQLAWPGE+FP+FEA+LGKWAPGGVMDADVYLALVT+HGTIMVFFVLT GLSGTFSNLLIPLQIGARDMASGFLNM+S Sbjct: 63 MQLAWPGESFPVFEALLGKWAPGGVMDADVYLALVTMHGTIMVFFVLTQGLSGTFSNLLIPLQIGARDMASGFLNMVS 140
BLAST of cytochrome c oxidase vs. nr
Match: gi|1055370029|ref|WP_067033578.1| (cytochrome c oxidase subunit I [Muricauda sp. CP2A]) HSP 1 Score: 154.451 bits (389), Expect = 1.229e-40 Identity = 73/78 (93.59%), Postives = 77/78 (98.72%), Query Frame = 0 Query: 1 MQLAWPGEAFPIFEAVLGKWAPGGVMDADVYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMIS 78 MQLAWPGE+FPIFEA+LGKWAP GVMDAD+YLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNM+S Sbjct: 58 MQLAWPGESFPIFEALLGKWAPDGVMDADIYLALVTIHGTIMVFFVLTAGLSGTFSNLLIPLQIGARDMASGFLNMLS 135 The following BLAST results are available for this feature:
BLAST of cytochrome c oxidase vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 0
BLAST of cytochrome c oxidase vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 1
BLAST of cytochrome c oxidase vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold3945_size7060:214..1131- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold3945_size7060-snap-gene-0.0 ID=maker-scaffold3945_size7060-snap-gene-0.0|Name=cytochrome c oxidase|organism=Tigriopus kingsejongensis|type=gene|length=918bp|location=Sequence derived from alignment at scaffold3945_size7060:214..1131- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'cytochrome c oxidase' has the following synonyms
Add to Basket
|