adp-ribosylation factor gtpase-activating protein 1-like isoform x3, maker-scaffold396_size184579-snap-gene-0.24 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. L. salmonis genes
Match: EMLSAG00000000350 (supercontig:LSalAtl2s:LSalAtl2s104:877817:880136:-1 gene:EMLSAG00000000350 transcript:EMLSAT00000000350 description:"maker-LSalAtl2s104-snap-gene-8.22") HSP 1 Score: 79.7221 bits (195), Expect = 1.985e-19 Identity = 31/56 (55.36%), Postives = 42/56 (75.00%), Query Frame = 0 Query: 10 LSELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMD 65 L+ + N CF+C ++NP W SVTYGI+IC++CSG HRSLGVH++FVRS +D Sbjct: 13 FKRLKSQSANKVCFDCGSNNPTWSSVTYGIFICIDCSGIHRSLGVHLTFVRSTVLD 68
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. L. salmonis genes
Match: EMLSAG00000009887 (supercontig:LSalAtl2s:LSalAtl2s643:209342:213124:-1 gene:EMLSAG00000009887 transcript:EMLSAT00000009887 description:"maker-LSalAtl2s643-augustus-gene-2.25") HSP 1 Score: 74.3294 bits (181), Expect = 1.855e-17 Identity = 31/67 (46.27%), Postives = 44/67 (65.67%), Query Frame = 0 Query: 2 ASPKTRRALSELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMDKWK 68 A K +R +L NN+C +C +P+W S+ GI +C+ECSG HRSLGVH+S VRS+ +D W+ Sbjct: 393 AVRKVKRTAGQLLQIPGNNRCCDCGAFDPKWASINLGITLCIECSGVHRSLGVHVSKVRSIELDGWE 459
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. L. salmonis genes
Match: EMLSAG00000002121 (supercontig:LSalAtl2s:LSalAtl2s139:1066244:1170379:-1 gene:EMLSAG00000002121 transcript:EMLSAT00000002121 description:"maker-LSalAtl2s139-augustus-gene-11.8") HSP 1 Score: 65.855 bits (159), Expect = 1.417e-14 Identity = 27/57 (47.37%), Postives = 39/57 (68.42%), Query Frame = 0 Query: 19 NNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMDKWKEFCPGKL 75 N+KC +C + +P W S+ G+ +C+ECSG HR LG H+S VRS+ +D+W PG L Sbjct: 605 NHKCVDCDSSSPLWASINLGVLMCIECSGVHRKLGSHISRVRSLDLDEWP---PGHL 658
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. L. salmonis genes
Match: EMLSAG00000002967 (supercontig:LSalAtl2s:LSalAtl2s170:1030725:1032950:-1 gene:EMLSAG00000002967 transcript:EMLSAT00000002967 description:"maker-LSalAtl2s170-augustus-gene-10.29") HSP 1 Score: 46.9802 bits (110), Expect = 7.378e-8 Identity = 16/46 (34.78%), Postives = 26/46 (56.52%), Query Frame = 0 Query: 22 CFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMDKW 67 C +C P W S+ GI +C +C HR+LG H+S ++++ W Sbjct: 16 CGDCGALGPSWASINRGILLCSDCCSVHRTLGRHVSHIKALRQSNW 61
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. SwissProt
Match: gi|729595|sp|P38682.1|GLO3_YEAST (RecName: Full=ADP-ribosylation factor GTPase-activating protein GLO3; Short=ARF GAP GLO3) HSP 1 Score: 76.6406 bits (187), Expect = 8.357e-17 Identity = 28/62 (45.16%), Postives = 43/62 (69.35%), Query Frame = 0 Query: 6 TRRALSELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMDKW 67 T++ +L EN CF+C NP W SV +G+ +C++CS HR++GVH++FV+S T+DKW Sbjct: 15 TQQVFQKLGSNMENRVCFDCGNKNPTWTSVPFGVMLCIQCSAVHRNMGVHITFVKSSTLDKW 76
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. SwissProt
Match: gi|166214908|sp|Q9D8S3.2|ARFG3_MOUSE (RecName: Full=ADP-ribosylation factor GTPase-activating protein 3; Short=ARF GAP 3) HSP 1 Score: 76.2554 bits (186), Expect = 1.029e-16 Identity = 33/74 (44.59%), Postives = 46/74 (62.16%), Query Frame = 0 Query: 1 MASPKTRRALS---ELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMD-KWKEF 70 M P + L+ LR N CF+C NP W S++YG+++C++CSG HRSLGVH+SF+RS +D W F Sbjct: 1 MGDPSKQDILAIFKRLRSVPTNKVCFDCGAKNPSWASISYGVFLCIDCSGSHRSLGVHLSFIRSTELDSNWSWF 74
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. SwissProt
Match: gi|123917636|sp|Q28CM8.1|ARFG2_XENTR (RecName: Full=ADP-ribosylation factor GTPase-activating protein 2; Short=ARF GAP 2; AltName: Full=GTPase-activating protein ZNF289; AltName: Full=Zinc finger protein 289) HSP 1 Score: 75.8702 bits (185), Expect = 1.613e-16 Identity = 30/62 (48.39%), Postives = 40/62 (64.52%), Query Frame = 0 Query: 10 LSELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMD-KWKEF 70 LR N CF+C NP W S+ YG+++C++CSG HRSLGVH+SF+RS +D W F Sbjct: 14 FKRLRAAPTNKSCFDCGAKNPSWASIPYGVFLCIDCSGVHRSLGVHLSFIRSTELDSNWSWF 75
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. SwissProt
Match: gi|123780788|sp|Q3MID3.1|ARFG2_RAT (RecName: Full=ADP-ribosylation factor GTPase-activating protein 2; Short=ARF GAP 2; AltName: Full=GTPase-activating protein ZNF289; AltName: Full=Zinc finger protein 289) HSP 1 Score: 75.0998 bits (183), Expect = 2.449e-16 Identity = 28/56 (50.00%), Postives = 39/56 (69.64%), Query Frame = 0 Query: 10 LSELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMD 65 LR N CF+C +P W S+TYG+++C++CSG HRSLGVH+SF+RS +D Sbjct: 14 FKRLRAIPTNKACFDCGAKSPSWASITYGVFLCIDCSGVHRSLGVHLSFIRSTELD 69
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. SwissProt
Match: gi|81880083|sp|Q99K28.1|ARFG2_MOUSE (RecName: Full=ADP-ribosylation factor GTPase-activating protein 2; Short=ARF GAP 2; AltName: Full=GTPase-activating protein ZNF289; AltName: Full=Zinc finger protein 289) HSP 1 Score: 75.0998 bits (183), Expect = 2.521e-16 Identity = 31/67 (46.27%), Postives = 44/67 (65.67%), Query Frame = 0 Query: 2 ASP---KTRRALSELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMD 65 ASP + + LR N CF+C +P W S+TYG+++C++CSG HRSLGVH+SF+RS +D Sbjct: 3 ASPSKTEIQTIFKRLRAIPTNKACFDCGAKSPSWASITYGVFLCIDCSGVHRSLGVHLSFIRSTELD 69
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. nr
Match: gi|1325259575|ref|XP_023328060.1| (ADP-ribosylation factor GTPase-activating protein 1-like isoform X2 [Eurytemora affinis]) HSP 1 Score: 144.05 bits (362), Expect = 2.949e-39 Identity = 63/77 (81.82%), Postives = 69/77 (89.61%), Query Frame = 0 Query: 1 MASPKTRRALSELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMDKWKEFCPGKLLN 77 MASP+TRR L+ELRPKDENNKCFEC THNPQWVSVTYGIWICLECSG+HR LGVH+SFVRSVTMDKWK+ K+ N Sbjct: 1 MASPRTRRVLAELRPKDENNKCFECGTHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKDLELNKMKN 77
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. nr
Match: gi|1325259567|ref|XP_023328052.1| (ADP-ribosylation factor GTPase-activating protein 1-like isoform X1 [Eurytemora affinis]) HSP 1 Score: 144.436 bits (363), Expect = 3.107e-39 Identity = 63/77 (81.82%), Postives = 69/77 (89.61%), Query Frame = 0 Query: 1 MASPKTRRALSELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMDKWKEFCPGKLLN 77 MASP+TRR L+ELRPKDENNKCFEC THNPQWVSVTYGIWICLECSG+HR LGVH+SFVRSVTMDKWK+ K+ N Sbjct: 1 MASPRTRRVLAELRPKDENNKCFECGTHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVTMDKWKDLELNKMKN 77
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. nr
Match: gi|1060234391|ref|XP_017842418.1| (PREDICTED: ADP-ribosylation factor GTPase-activating protein 1 isoform X3 [Drosophila busckii]) HSP 1 Score: 138.658 bits (348), Expect = 1.802e-38 Identity = 59/70 (84.29%), Postives = 66/70 (94.29%), Query Frame = 0 Query: 1 MASPKTRRALSELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMDKWKEF 70 MASP+TRR L EL+P+DEN+KCFEC THNPQWVSVTYGIWICLECSG+HRSLGVH+SFVRSVTMDKWK+ Sbjct: 1 MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDI 70
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. nr
Match: gi|1070591844|ref|XP_018392886.1| (PREDICTED: ADP-ribosylation factor GTPase-activating protein 1 isoform X3 [Cyphomyrmex costatus]) HSP 1 Score: 140.584 bits (353), Expect = 2.326e-38 Identity = 59/69 (85.51%), Postives = 66/69 (95.65%), Query Frame = 0 Query: 1 MASPKTRRALSELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMDKWKE 69 MASPKTRR LSEL+PKDENNKCFEC +HNPQWVSVTYGIWICLECSG+HR LGVH+SFVRS++MDKWK+ Sbjct: 1 MASPKTRRVLSELKPKDENNKCFECDSHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKD 69
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. nr
Match: gi|1070591840|ref|XP_018392884.1| (PREDICTED: ADP-ribosylation factor GTPase-activating protein 1 isoform X1 [Cyphomyrmex costatus]) HSP 1 Score: 140.584 bits (353), Expect = 2.960e-38 Identity = 59/69 (85.51%), Postives = 66/69 (95.65%), Query Frame = 0 Query: 1 MASPKTRRALSELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMDKWKE 69 MASPKTRR LSEL+PKDENNKCFEC +HNPQWVSVTYGIWICLECSG+HR LGVH+SFVRS++MDKWK+ Sbjct: 1 MASPKTRRVLSELKPKDENNKCFECDSHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKD 69
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. nr
Match: gi|1070591842|ref|XP_018392885.1| (PREDICTED: ADP-ribosylation factor GTPase-activating protein 1 isoform X2 [Cyphomyrmex costatus]) HSP 1 Score: 140.584 bits (353), Expect = 3.075e-38 Identity = 59/69 (85.51%), Postives = 66/69 (95.65%), Query Frame = 0 Query: 1 MASPKTRRALSELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMDKWKE 69 MASPKTRR LSEL+PKDENNKCFEC +HNPQWVSVTYGIWICLECSG+HR LGVH+SFVRS++MDKWK+ Sbjct: 1 MASPKTRRVLSELKPKDENNKCFECDSHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKD 69
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. nr
Match: gi|571548246|ref|XP_006561635.1| (PREDICTED: ADP-ribosylation factor GTPase-activating protein 1 isoform X2 [Apis mellifera]) HSP 1 Score: 139.813 bits (351), Expect = 3.544e-38 Identity = 59/70 (84.29%), Postives = 66/70 (94.29%), Query Frame = 0 Query: 1 MASPKTRRALSELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMDKWKEF 70 MASP+TRR LSEL+PKDENNKCFEC THNPQWVSVTYGIWICLECSG+HR LGVH+SFVRS++MDKWK+ Sbjct: 1 MASPRTRRILSELKPKDENNKCFECGTHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDL 70
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. nr
Match: gi|1070206844|ref|XP_018372400.1| (PREDICTED: ADP-ribosylation factor GTPase-activating protein 1 isoform X2 [Trachymyrmex cornetzi]) HSP 1 Score: 139.813 bits (351), Expect = 4.728e-38 Identity = 59/69 (85.51%), Postives = 66/69 (95.65%), Query Frame = 0 Query: 1 MASPKTRRALSELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMDKWKE 69 MASP+TRR LSEL+PKDENNKCFEC +HNPQWVSVTYGIWICLECSG+HR LGVH+SFVRSV+MDKWK+ Sbjct: 1 MASPRTRRVLSELKPKDENNKCFECGSHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVSMDKWKD 69
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. nr
Match: gi|805799962|ref|XP_012144272.1| (PREDICTED: ADP-ribosylation factor GTPase-activating protein 1 [Megachile rotundata]) HSP 1 Score: 140.198 bits (352), Expect = 5.317e-38 Identity = 58/70 (82.86%), Postives = 66/70 (94.29%), Query Frame = 0 Query: 1 MASPKTRRALSELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMDKWKEF 70 MASP+TRR L+EL+PKDENNKCFEC THNPQWVSVTYGIWICLECSG+HR LGVH+SFVRS++MDKWK+ Sbjct: 1 MASPRTRRVLNELKPKDENNKCFECGTHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDL 70
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. nr
Match: gi|746845629|ref|XP_011053108.1| (PREDICTED: ADP-ribosylation factor GTPase-activating protein 1 isoform X2 [Acromyrmex echinatior]) HSP 1 Score: 139.428 bits (350), Expect = 5.847e-38 Identity = 59/69 (85.51%), Postives = 66/69 (95.65%), Query Frame = 0 Query: 1 MASPKTRRALSELRPKDENNKCFECQTHNPQWVSVTYGIWICLECSGQHRSLGVHMSFVRSVTMDKWKE 69 MASP+TRR LSEL+PKDENNKCFEC +HNPQWVSVTYGIWICLECSG+HR LGVH+SFVRSV+MDKWK+ Sbjct: 1 MASPRTRRVLSELKPKDENNKCFECGSHNPQWVSVTYGIWICLECSGKHRGLGVHLSFVRSVSMDKWKD 69 The following BLAST results are available for this feature:
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 4
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 25
Pagesback to top
BLAST of adp-ribosylation factor gtpase-activating protein 1-like isoform x3 vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold396_size184579:84679..85133- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold396_size184579-snap-gene-0.24 ID=maker-scaffold396_size184579-snap-gene-0.24|Name=adp-ribosylation factor gtpase-activating protein 1-like isoform x3|organism=Tigriopus kingsejongensis|type=gene|length=455bp|location=Sequence derived from alignment at scaffold396_size184579:84679..85133- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'adp-ribosylation factor gtpase-activating protein 1-like isoform x3' has the following synonyms
Add to Basket
|