vacuolar protein sorting, maker-scaffold430_size173499-snap-gene-0.43 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of vacuolar protein sorting vs. L. salmonis genes
Match: EMLSAG00000000628 (supercontig:LSalAtl2s:LSalAtl2s109:771638:773491:1 gene:EMLSAG00000000628 transcript:EMLSAT00000000628 description:"snap_masked-LSalAtl2s109-processed-gene-8.12") HSP 1 Score: 53.1434 bits (126), Expect = 1.097e-8 Identity = 27/53 (50.94%), Postives = 31/53 (58.49%), Query Frame = 0 Query: 172 NIIRLFQATGMDHMNMFPYVRAALIGHATRNDVKSAGGGSFNRRGNSCAQMYR 224 N+ F ATG+D MN FPYVRA LIG A+ R GNSCA+MYR Sbjct: 110 NLFSNFIATGLDSMNAFPYVRAGLIGQASD---------PLERGGNSCARMYR 153 The following BLAST results are available for this feature:
BLAST of vacuolar protein sorting vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of vacuolar protein sorting vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of vacuolar protein sorting vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold430_size173499:159010..159870+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold430_size173499-snap-gene-0.43 ID=maker-scaffold430_size173499-snap-gene-0.43|Name=vacuolar protein sorting|organism=Tigriopus kingsejongensis|type=gene|length=861bp|location=Sequence derived from alignment at scaffold430_size173499:159010..159870+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'vacuolar protein sorting' has the following synonyms
Add to Basket
|