achain crystal structure of engineered northeast structural genomics consortium target, maker-scaffold462_size163801-snap-gene-0.39 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. L. salmonis genes
Match: EMLSAG00000012208 (supercontig:LSalAtl2s:LSalAtl2s884:7796:22423:1 gene:EMLSAG00000012208 transcript:EMLSAT00000012208 description:"maker-LSalAtl2s884-snap-gene-0.6") HSP 1 Score: 57.7658 bits (138), Expect = 6.100e-10 Identity = 31/70 (44.29%), Postives = 42/70 (60.00%), Query Frame = 0 Query: 76 LKKQANIVKYLVSKGADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHVDQEGLTCEDWAVKYR 145 LK Q V YL+ +G D++ A + G TPL LA G SE+V+LLL+KGA + H D G+ D A+ R Sbjct: 1197 LKGQCEAVSYLIDQGCDISVADNT-GRTPLDLASFKGNSEIVTLLLEKGASMEHTDINGMRPLDRAISCR 1265 HSP 2 Score: 49.2914 bits (116), Expect = 3.694e-7 Identity = 26/76 (34.21%), Postives = 40/76 (52.63%), Query Frame = 0 Query: 81 NIVKYLVSKGADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHVDQEGLTCEDW--------AVKYRWDQ 148 N+ +L+ +GA + Q S G +PL +A M G +V L + +GA + D++G+TC W AV Y DQ Sbjct: 1136 NVTDFLLREGAHIEQV-DSTGKSPLIIACMEGHLGLVELFVSRGADMTRADRDGITCIGWACLKGQCEAVSYLIDQ 1210
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. L. salmonis genes
Match: EMLSAG00000004172 (supercontig:LSalAtl2s:LSalAtl2s220:361601:366450:1 gene:EMLSAG00000004172 transcript:EMLSAT00000004172 description:"maker-LSalAtl2s220-augustus-gene-3.26") HSP 1 Score: 53.5286 bits (127), Expect = 1.380e-8 Identity = 27/75 (36.00%), Postives = 41/75 (54.67%), Query Frame = 0 Query: 82 IVKYLVSKGADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHV-DQEGLTCEDWAVKYRWDQIKTQLML 155 + K LV GADVN S GWTPL A G E+V L+ + + ++ D +G T E WA++ W+ K +++ Sbjct: 46 VAKLLVEGGADVNIRNESPGWTPLHFASYEGHLELVKFLVNEARAIPNIKDNQGDTPETWALE--WENYKCAMVI 118
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. L. salmonis genes
Match: EMLSAG00000008062 (supercontig:LSalAtl2s:LSalAtl2s47:241369:243591:1 gene:EMLSAG00000008062 transcript:EMLSAT00000008062 description:"maker-LSalAtl2s47-snap-gene-2.37") HSP 1 Score: 47.7506 bits (112), Expect = 1.667e-7 Identity = 25/79 (31.65%), Postives = 46/79 (58.23%), Query Frame = 0 Query: 30 FLAACSNLNQRSIFNAVESDKLDVTRTTDAIEQNGLHFVVSSA-KHDLKKQANIVKYLVSKGADVNQARTSDGWTPLFL 107 FL AC +L+ + + ++ D LD D + QNG H+ V S +++ +Q +++KYL KG +N++ T+ P+F+ Sbjct: 48 FLGACGSLDIKKMREILDKDDLDPNDIVDDVGQNGFHYAVCSILRNNTSRQTSVLKYLRKKG--LNES-TNASSGPIFV 123
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. L. salmonis genes
Match: EMLSAG00000003838 (supercontig:LSalAtl2s:LSalAtl2s2086:4561:15986:1 gene:EMLSAG00000003838 transcript:EMLSAT00000003838 description:"maker-LSalAtl2s2086-augustus-gene-0.4") HSP 1 Score: 48.521 bits (114), Expect = 6.447e-7 Identity = 29/73 (39.73%), Postives = 42/73 (57.53%), Query Frame = 0 Query: 83 VKYLVSKGADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHVDQEGLTCEDWAVKYRWDQIKTQLML 155 V++L+SKGAD+N+ T++ TPL LA G VV LLLQ GA H ++ T A K + + QL++ Sbjct: 746 VQFLISKGADINRPTTNNDHTPLSLACAGGHLSVVELLLQAGADPYHKLRDNSTMIIEAAKGGYTSV-VQLLI 817
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. SwissProt
Match: gi|27151762|sp|Q05753.2|AKRP_ARATH (RecName: Full=Ankyrin repeat domain-containing protein, chloroplastic; Short=AKRP; AltName: Full=Protein EMBRYO DEFECTIVE 2036; Flags: Precursor) HSP 1 Score: 53.5286 bits (127), Expect = 3.372e-7 Identity = 37/101 (36.63%), Postives = 57/101 (56.44%), Query Frame = 0 Query: 65 LHFVVSSAKHDLKKQANIVKYLVSKGADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHVDQEGLTCEDWAVKYRWDQIKT-QLMLHRSKLPHSR 164 +H+ V +A A +K L+ AD+N A+ DGWTPL +AV RS++V LLL KGA + +++GLT + Y +I+T ++M + P SR Sbjct: 330 MHYAVQTA------SAPTIKLLLLYNADIN-AQDRDGWTPLHVAVQARRSDIVKLLLIKGADIEVKNKDGLTPLGLCL-YLGREIRTYEVMKLLKEFPLSR 422
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. SwissProt
Match: gi|410591585|sp|G5E8K5.1|ANK3_MOUSE (RecName: Full=Ankyrin-3; Short=ANK-3; AltName: Full=Ankyrin-G) HSP 1 Score: 53.1434 bits (126), Expect = 5.426e-7 Identity = 31/84 (36.90%), Postives = 49/84 (58.33%), Query Frame = 0 Query: 76 LKKQANIVKYLVSKGADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHVDQEGLTCEDWAVKYRWDQIKTQLMLHRSK 159 L QA +VK LV+ GA+VN A++ +G+TPL++A EVV LL GA ++G T A++ DQ+ + L+ + +K Sbjct: 99 LAGQAEVVKVLVTNGANVN-AQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK 181
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Match: gi|1325262155|ref|XP_023332112.1| (calponin homology domain-containing protein DDB_G0272472-like [Eurytemora affinis]) HSP 1 Score: 70.0922 bits (170), Expect = 3.319e-10 Identity = 40/96 (41.67%), Postives = 53/96 (55.21%), Query Frame = 0 Query: 58 DAIEQNGLHFVVSSAKHDLKKQANIVKYLVSKGADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHVDQEGLTCEDWAVKYRWDQIKTQL 153 D + Q LH+ + L + + Y++ G +VN R DGWTP+FLA G S+VV LL++ GA V D GLT EDWA KYR I+ L Sbjct: 78 DCVHQTPLHYSI------LTNNIDSISYIIKCGGNVNVRRMKDGWTPVFLAATFGTSQVVRLLVEAGADVLLADNLGLTPEDWAAKYRLKTIQQIL 167
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Match: gi|1133484504|ref|XP_019860424.1| (PREDICTED: ankyrin repeat domain-containing protein 7-like [Amphimedon queenslandica]) HSP 1 Score: 62.3882 bits (150), Expect = 3.637e-9 Identity = 31/66 (46.97%), Postives = 46/66 (69.70%), Query Frame = 0 Query: 76 LKKQANIVKYLVSKGADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHVDQEGLTCEDWA 141 L ++N V++L+SKGAD+ ++R DGWTPL +A G ++VV++LL+KGA V D G T D+A Sbjct: 13 LYNRSNAVQWLLSKGADL-ESRDDDGWTPLIVAAANGHTQVVTMLLEKGADVTASDNAGKTALDYA 77
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Match: gi|1325276013|ref|XP_023322694.1| (uncharacterized protein LOC111697053 [Eurytemora affinis]) HSP 1 Score: 66.6254 bits (161), Expect = 5.601e-9 Identity = 35/86 (40.70%), Postives = 52/86 (60.47%), Query Frame = 0 Query: 60 IEQNGLHFVVSSAKHDLKKQANIVKYLVSKGADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHVDQEGLTCEDWAVKYR 145 I+Q G + + H L + +IV L+ GA+ N R +D W+PLF+ MLGR++V ++LLQ GA D++G T ED A +YR Sbjct: 89 IDQAGQTPLFYAVSHQLAE--DIVPILLRAGANPNVQRKADQWSPLFICAMLGRTQVANILLQSGADPDLEDEDGRTAEDVAKEYR 172
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Match: gi|1125530050|gb|OLE46539.1| (hypothetical protein AUG46_09270 [Acidobacteria bacterium 13_1_20CM_3_58_11]) HSP 1 Score: 64.6994 bits (156), Expect = 2.276e-8 Identity = 35/80 (43.75%), Postives = 52/80 (65.00%), Query Frame = 0 Query: 58 DAIEQNGLHFVVSSAKHDLKKQANIVKYLVSKGADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHVDQEGLTC 137 +A ++G+ ++++A D + +IV L+ KGADVN A+ +DGWTPLF A GR+E+V LL+KGA V +D G T Sbjct: 110 NAKGKDGITALMNAASADYR---DIVHSLLEKGADVN-AKDNDGWTPLFWAAFSGRAEIVRALLEKGADVNAMDDSGKTV 185
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Match: gi|1005951942|ref|XP_015784328.1| (PREDICTED: ankyrin repeat and MYND domain-containing protein 2-like [Tetranychus urticae]) HSP 1 Score: 63.929 bits (154), Expect = 3.598e-8 Identity = 36/107 (33.64%), Postives = 58/107 (54.21%), Query Frame = 0 Query: 38 NQRSIF-----NAVESDKLDVTRT---TDAIEQNGLHFVVSSAKHDLKKQANIVKYLVSKGADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHVDQEGLT 136 N++ IF N +E KL + + +A+++NG+ F+ +A K I K+L+ GADVN R G+T L A + G +VV +LL+ GA + H++ G T Sbjct: 10 NEKLIFEKICENNLEEVKLLMNKDDVRLNAVDENGMSFLCQAA---FKGSYEICKFLIENGADVNNTRHVHGYTALMFAAIGGHLKVVGILLEAGADINHINSVGRT 113
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Match: gi|1183359081|gb|ORX86522.1| (ankyrin, partial [Anaeromyces robustus]) HSP 1 Score: 58.9214 bits (141), Expect = 4.290e-8 Identity = 26/56 (46.43%), Postives = 37/56 (66.07%), Query Frame = 0 Query: 81 NIVKYLVSKGADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHVDQEGLT 136 NI+KYLV +GAD+N+ ++GWTPLF A G VV L++KGA + + +G T Sbjct: 23 NIIKYLVEQGADINK-EDNEGWTPLFSACERGYENVVKYLVEKGANINKKNNDGWT 77
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Match: gi|414145861|pdb|4HQD|A (Chain A, Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR265. >gi|414145862|pdb|4HQD|B Chain B, Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR265.) HSP 1 Score: 61.2326 bits (147), Expect = 5.094e-8 Identity = 44/125 (35.20%), Postives = 62/125 (49.60%), Query Frame = 0 Query: 30 FLAACSNLNQRSIFNAVESDKLDVTRTTDAIEQNGLHFVVSSAKHDLKKQANIVKYLVSKGADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHVDQEGLTCEDWAVKYRWDQIKTQLM 154 + A N N+ + + +E+ DV +D+ + LH+ IVK L+SKGADVN A+ SDG TPL A G E+V LL+ KGA V D +G T +A K +I L+ Sbjct: 8 LIEAAENGNKDRVKDLIEN-GADVN-ASDSDGRTPLHYAAKEG------HKEIVKLLISKGADVN-AKDSDGRTPLHYAAKEGHKEIVKLLISKGADVNAKDSDGRTPLHYAAKEGHKEIVKLLI 123 HSP 2 Score: 59.3066 bits (142), Expect = 2.454e-7 Identity = 34/68 (50.00%), Postives = 43/68 (63.24%), Query Frame = 0 Query: 82 IVKYLVSKGADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHVDQEGLTCEDWAVKYRWDQI 149 IVK L+SKGADVN A+ SDG TPL A G E+V LL+ KGA V D +G T D A ++ ++I Sbjct: 85 IVKLLISKGADVN-AKDSDGRTPLHYAAKEGHKEIVKLLISKGADVNTSDSDGRTPLDLAREHGNEEI 151
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Match: gi|947409040|ref|WP_056074922.1| (ankyrin repeat domain-containing protein [Chryseobacterium sp. Leaf394] >gi|945236107|gb|KQS94265.1| hypothetical protein ASG21_18700 [Chryseobacterium sp. Leaf394]) HSP 1 Score: 60.077 bits (144), Expect = 8.230e-8 Identity = 32/68 (47.06%), Postives = 41/68 (60.29%), Query Frame = 0 Query: 82 IVKYLVSKGADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHVDQEGLTCEDWAVKYRWDQI 149 I YL++ GADVN A +G TPL A E+ LLL+KGA D EGLT +D+AVKY+ +I Sbjct: 75 IFNYLLANGADVNLA--CNGNTPLMEAAKFDAPELAKLLLKKGADKNAKDAEGLTAKDYAVKYKRTEI 140
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Match: gi|1168107157|gb|OQE07237.1| (hypothetical protein PENVUL_c014G02495 [Penicillium vulpinum]) HSP 1 Score: 62.3882 bits (150), Expect = 8.314e-8 Identity = 44/117 (37.61%), Postives = 60/117 (51.28%), Query Frame = 0 Query: 55 RTTDA-IEQNGLHFVVSSAKHD----------LKKQANIVKYLVSKG-ADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHVDQEGLTCEDWAVKYRWDQIKTQLMLHRSK 159 RT+D+ I LHF + + +D K IV+ L+ +G DVN + SDG TPL A++ VV LLL GAR+ D+EG + WAV YR I L+ HR+K Sbjct: 168 RTSDSDIRPESLHFQLPQSHNDDTIGALHIAAQKGHERIVRVLLIRGNIDVNN-QDSDGRTPLIYAIIENHDPVVRLLLSHGARIAVYDREGRSGLHWAVLYRRLGILQHLLDHRAK 283
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Match: gi|1041569181|gb|ANO58269.1| (ankyrin repeat protein [uncultured planctomycete]) HSP 1 Score: 60.8474 bits (146), Expect = 8.719e-8 Identity = 39/99 (39.39%), Postives = 48/99 (48.48%), Query Frame = 0 Query: 61 EQNGLHFVVSSAKHDLKKQANIVKYLVSKGADVNQARTSDGWTPLFLAVMLGRSEVVSLLLQKGARVRHVDQEGLTCEDWAVKYRWDQIKTQLMLHRSK 159 E LHF S + L Q IV+ L++KGADVN A+ TPL G SE+ LLL GA V D E T DWA+ +W + L H K Sbjct: 81 EWTPLHFAALSFLNPLHDQKGIVELLIAKGADVN-AKHRGELTPLHYVTSGGHSELAELLLANGADVNAKDFENRTPLDWAIDSKWLKTAALLRKHGGK 178 The following BLAST results are available for this feature:
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 4
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 12
Pagesback to top
BLAST of achain crystal structure of engineered northeast structural genomics consortium target vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold462_size163801:1979..3830- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold462_size163801-snap-gene-0.39 ID=maker-scaffold462_size163801-snap-gene-0.39|Name=achain crystal structure of engineered northeast structural genomics consortium target|organism=Tigriopus kingsejongensis|type=gene|length=1852bp|location=Sequence derived from alignment at scaffold462_size163801:1979..3830- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'achain crystal structure of engineered northeast structural genomics consortium target' has the following synonyms
Add to Basket
|