acetone carboxylase subunit beta, maker-scaffold589_size129586-snap-gene-0.34 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of acetone carboxylase subunit beta vs. L. salmonis genes
Match: EMLSAG00000005723 (supercontig:LSalAtl2s:LSalAtl2s309:690667:692802:-1 gene:EMLSAG00000005723 transcript:EMLSAT00000005723 description:"maker-LSalAtl2s309-augustus-gene-7.90") HSP 1 Score: 54.299 bits (129), Expect = 1.074e-8 Identity = 47/182 (25.82%), Postives = 93/182 (51.10%), Query Frame = 0 Query: 97 YLSVARLTESVAELTEHRTRSE-------KYLQFLQEKHQYNANMSTEIRNLREATKIQHQHPVGLDGEKNAANGK----KELQSKIREFIKSYKTIKTFLGELLVQISPEQNEGEGSLLAHLLQALWTLSFS---ASGPDAYLTLSQFAQRVEPRDVNLLVTNEIVERDPDNPDRVRMINF 264 +L++A + +++ L E + SE ++++ + Q ++ E R E +K+ G +G+++ G+ K+L++ IR+ +YK IK+ L +I + E + + LQALWT S++ ++ +YL +S V DV+ LV+ I+ PD+PD+V+++ F Sbjct: 427 FLAIAGMQKNIQNLRELKQMSEHILSNNMEHIKEMDNIVQLRDSIDHECREKMEKSKVDK----GNEGDQSRPEGEAETIKDLEANIRDTRAAYKHIKSEFAAFLERI----DHNEINQIGMFLQALWT-SYAKNVSNDESSYLRISHLDFDVNQNDVSKLVSEGIITAHPDDPDQVKLMRF 599 The following BLAST results are available for this feature:
BLAST of acetone carboxylase subunit beta vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of acetone carboxylase subunit beta vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of acetone carboxylase subunit beta vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold589_size129586:10144..11082+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold589_size129586-snap-gene-0.34 ID=maker-scaffold589_size129586-snap-gene-0.34|Name=acetone carboxylase subunit beta|organism=Tigriopus kingsejongensis|type=gene|length=939bp|location=Sequence derived from alignment at scaffold589_size129586:10144..11082+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'acetone carboxylase subunit beta' has the following synonyms
Add to Basket
|