radical sam domain protein, maker-scaffold642_size120736-snap-gene-0.23 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of radical sam domain protein vs. nr
Match: gi|1325277170|ref|XP_023323221.1| (uncharacterized protein LOC111697431 [Eurytemora affinis]) HSP 1 Score: 63.5438 bits (153), Expect = 3.284e-8 Identity = 44/140 (31.43%), Postives = 67/140 (47.86%), Query Frame = 0 Query: 28 TLPFLT-SYPIITTRGRNSEQFDANEGFFIQYVMKFHPGTRSDYKFKVAPPPNVR---ICQMAILHIGDNFPCAQPPG--PSPTGHENIELVYDTIGSTPNGCGRDAEYTFWGLTNWGREPIISDLTPDEDSIQIVAYFQ 161 T P L+ + PI+ E D I++VMK P TR+ YKF+ P ++ IC+M + IG+N PCA P E + + Y S+ G LTNWG+ P+ DL DE++++I +F+ Sbjct: 692 TFPELSLTTPILKAYNAPIETIDVGGIRHIRHVMKTRPQTRALYKFEAIPFSDLNVGYICKMRVRKIGNNMPCATIPSGFVDKNYFEKVNIDYKDKTSSIINLGL--------LTNWGQLPMQEDLYADENAVEIDVFFR 823 The following BLAST results are available for this feature:
BLAST of radical sam domain protein vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 0
BLAST of radical sam domain protein vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of radical sam domain protein vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold642_size120736:103077..103791+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold642_size120736-snap-gene-0.23 ID=maker-scaffold642_size120736-snap-gene-0.23|Name=radical sam domain protein|organism=Tigriopus kingsejongensis|type=gene|length=715bp|location=Sequence derived from alignment at scaffold642_size120736:103077..103791+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'radical sam domain protein' has the following synonyms
Add to Basket
|