type iv pilus-associated protein, maker-scaffold74_size411160-snap-gene-3.17 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of type iv pilus-associated protein vs. L. salmonis genes
Match: EMLSAG00000007166 (supercontig:LSalAtl2s:LSalAtl2s403:189750:191334:-1 gene:EMLSAG00000007166 transcript:EMLSAT00000007166 description:"maker-LSalAtl2s403-snap-gene-2.29") HSP 1 Score: 49.6766 bits (117), Expect = 3.651e-8 Identity = 28/92 (30.43%), Postives = 47/92 (51.09%), Query Frame = 0 Query: 36 QCFVDGECLDSMLIDVEPTNTSSMCLHHCQNTRGCEWFTWYKDTSLCASLSVCLRLNGTYCGDNCVSGEVECPEFYCGVKGKCLGALEGMRL 127 +C ++ EC +S + + T C C T+ C W+T+ + LC +L C +N C D C++ ++ECP C G+C G G+R+ Sbjct: 28 RCDLNQECTNSHWKNFKLTEGKEKCQELCSKTKECHWYTYVAHSKLCIALKEC--INFKDCKD-CITSQIECPR--CFKVGRCEGT--GIRV 112 The following BLAST results are available for this feature:
BLAST of type iv pilus-associated protein vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of type iv pilus-associated protein vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of type iv pilus-associated protein vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold74_size411160:358980..359460+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold74_size411160-snap-gene-3.17 ID=maker-scaffold74_size411160-snap-gene-3.17|Name=type iv pilus-associated protein|organism=Tigriopus kingsejongensis|type=gene|length=481bp|location=Sequence derived from alignment at scaffold74_size411160:358980..359460+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'type iv pilus-associated protein' has the following synonyms
Add to Basket
|