zgc:103474 protein, maker-scaffold798_size95657-snap-gene-0.31 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of zgc:103474 protein vs. nr
Match: gi|1325270026|ref|XP_023319593.1| (uncharacterized protein LOC111694799 [Eurytemora affinis]) HSP 1 Score: 74.7146 bits (182), Expect = 3.655e-12 Identity = 37/107 (34.58%), Postives = 63/107 (58.88%), Query Frame = 0 Query: 1 MAVPDSWTQVPGFPIASQSYNATTSGSNTSLSYVLPSSYFESIANISQIEFVPLTTGQLMIDIVSPVC----DSGLS-----WCALIRACTASCATHLESQNMFDAQ 98 + VPD + +PG P+ +QS+N T + ++ S+++ S+YF+ + NIS+IE+VP T G ++D++ P C D S WC L AC +C + L+ Q +D + Sbjct: 411 LKVPDQFIFIPGGPLKTQSWNHTLALNSQGSSFIIQSTYFKFMGNISEIEYVPATAGTFLVDVIYPECPVVRDPAGSWVQTWWCPLTGACEINCLSTLQMQEDWDTE 517 The following BLAST results are available for this feature:
BLAST of zgc:103474 protein vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 0
BLAST of zgc:103474 protein vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of zgc:103474 protein vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold798_size95657:26312..28150- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold798_size95657-snap-gene-0.31 ID=maker-scaffold798_size95657-snap-gene-0.31|Name=zgc:103474 protein|organism=Tigriopus kingsejongensis|type=gene|length=1839bp|location=Sequence derived from alignment at scaffold798_size95657:26312..28150- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'zgc:103474 protein' has the following synonyms
Add to Basket
|