upf0414 transmembrane protein c20orf30 homolog isoform 2, maker-scaffold804_size94796-snap-gene-0.23 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of upf0414 transmembrane protein c20orf30 homolog isoform 2 vs. L. salmonis genes
Match: EMLSAG00000009902 (supercontig:LSalAtl2s:LSalAtl2s645:218314:218652:1 gene:EMLSAG00000009902 transcript:EMLSAT00000009902 description:"augustus_masked-LSalAtl2s645-processed-gene-2.1") HSP 1 Score: 47.7506 bits (112), Expect = 3.647e-8 Identity = 38/123 (30.89%), Postives = 57/123 (46.34%), Query Frame = 0 Query: 36 RKPASISGNADFDPSQFEPSYVSIQ-IPWKSLILGLFLLACSLICFFMLIQDLSHTLSGGKPELIARKNENGQEEMVEFRS----ERFWSLIILGFISFPPGIYVTFLFLMATLKIPGYTYDD 153 RKP + S + DF P Q++ YV + IPWKS+ FL +C +SG +++FR+ +R W LII+G + F PG Y ++ A + PGY +DD Sbjct: 13 RKPKTRSTD-DFVPEQYQ--YVLKESIPWKSIGFATFLFLVGGLC----------IVSG---------------SLIQFRTLEEDDRIWPLIIIGCLMFIPGSYHVYIAFRALIGSPGYNFDD 107 The following BLAST results are available for this feature:
BLAST of upf0414 transmembrane protein c20orf30 homolog isoform 2 vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of upf0414 transmembrane protein c20orf30 homolog isoform 2 vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of upf0414 transmembrane protein c20orf30 homolog isoform 2 vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold804_size94796:88515..91299- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold804_size94796-snap-gene-0.23 ID=maker-scaffold804_size94796-snap-gene-0.23|Name=upf0414 transmembrane protein c20orf30 homolog isoform 2|organism=Tigriopus kingsejongensis|type=gene|length=2785bp|location=Sequence derived from alignment at scaffold804_size94796:88515..91299- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'upf0414 transmembrane protein c20orf30 homolog isoform 2' has the following synonyms
Add to Basket
|