Ca, maker-scaffold987_size73085-snap-gene-0.6 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of Ca vs. L. salmonis genes
Match: EMLSAG00000012432 (supercontig:LSalAtl2s:LSalAtl2s910:17613:93877:-1 gene:EMLSAG00000012432 transcript:EMLSAT00000012432 description:"maker-LSalAtl2s910-snap-gene-0.10") HSP 1 Score: 62.7734 bits (151), Expect = 3.306e-12 Identity = 43/94 (45.74%), Postives = 56/94 (59.57%), Query Frame = 0 Query: 89 LSTFKPPQGSPMLLKVPGPPNNHAHHHHRTSSGVDLGSHRSSGDGGSEIDTESDAPYATLKIMAEMETEEEEESHYSLIRQPDGRADDPAYSPL 182 +STF+P Q SP L + + H HH S G RS+GDGGS +D +A YATL + + + E SHY+LIR+PDGRAD+P YS L Sbjct: 478 MSTFRPHQNSP--LPILPSSSQHLHHSRDVSGGSSSIGGRSAGDGGSVVD---EANYATL-LQENIADNDNESSHYTLIRKPDGRADEPNYSTL 565 The following BLAST results are available for this feature:
BLAST of Ca vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of Ca vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of Ca vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold987_size73085:5959..8061- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>maker-scaffold987_size73085-snap-gene-0.6 ID=maker-scaffold987_size73085-snap-gene-0.6|Name=Ca|organism=Tigriopus kingsejongensis|type=gene|length=2103bp|location=Sequence derived from alignment at scaffold987_size73085:5959..8061- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'Ca' has the following synonyms
Add to Basket
|