troponin i, snap_masked-scaffold1743_size29358-processed-gene-0.5 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of troponin i vs. L. salmonis genes
Match: EMLSAG00000006163 (supercontig:LSalAtl2s:LSalAtl2s336:578832:579637:-1 gene:EMLSAG00000006163 transcript:EMLSAT00000006163 description:"maker-LSalAtl2s336-augustus-gene-6.38") HSP 1 Score: 89.7373 bits (221), Expect = 1.749e-21 Identity = 43/51 (84.31%), Postives = 49/51 (96.08%), Query Frame = 0 Query: 1 LRTLLRKKAAEELKKEQERKAAERQRVISERCGSKKDIENAGDEDLKKIIT 51 LRTLLRKKAAEELKKEQERKAAER+R+I+ERCGSKKDIEN G+E+LK I+T Sbjct: 47 LRTLLRKKAAEELKKEQERKAAERERIINERCGSKKDIENVGEEELKTIVT 97
BLAST of troponin i vs. L. salmonis genes
Match: EMLSAG00000003278 (supercontig:LSalAtl2s:LSalAtl2s17:231643:241722:1 gene:EMLSAG00000003278 transcript:EMLSAT00000003278 description:"snap_masked-LSalAtl2s17-processed-gene-2.5") HSP 1 Score: 51.9878 bits (123), Expect = 5.319e-8 Identity = 26/47 (55.32%), Postives = 34/47 (72.34%), Query Frame = 0 Query: 9 AAEELKKEQERKAAERQRVISERCGSKKDIENAGDEDLKKIITTTSG 55 AAEELKKEQERKAAER+RVI +RCG+ K +E ++ ++ I G Sbjct: 50 AAEELKKEQERKAAERRRVIDQRCGTAKSLEGLSEDQIRAICKQYHG 96
BLAST of troponin i vs. SwissProt
Match: gi|136223|sp|P05547.1|TNNI_ASTLP (RecName: Full=Troponin I; Short=TnI) HSP 1 Score: 55.0694 bits (131), Expect = 1.218e-7 Identity = 31/73 (42.47%), Postives = 43/73 (58.90%), Query Frame = 0 Query: 9 AAEELKKEQERKAAERQRVISERCGSKKDIENAGDEDLKKIITTTSGFSASHCFKIFDLSFLFILVASESNCL 81 AAEELKKEQERKA ER+++I +RCG K+++ A +E L+ II +A +D+ I E N L Sbjct: 57 AAEELKKEQERKAGERRKIIDQRCGQPKNLDGANEEQLRAIIKEYFDHTAQIESDKYDVELEIIRKDYEINEL 129
BLAST of troponin i vs. nr
Match: gi|225712756|gb|ACO12224.1| (Troponin I [Lepeophtheirus salmonis] >gi|290462481|gb|ADD24288.1| Troponin I [Lepeophtheirus salmonis]) HSP 1 Score: 88.5817 bits (218), Expect = 1.835e-17 Identity = 43/51 (84.31%), Postives = 49/51 (96.08%), Query Frame = 0 Query: 1 LRTLLRKKAAEELKKEQERKAAERQRVISERCGSKKDIENAGDEDLKKIIT 51 LRTLLRKKAAEELKKEQERKAAER+R+I+ERCGSKKDIEN G+E+LK I+T Sbjct: 16 LRTLLRKKAAEELKKEQERKAAERERIINERCGSKKDIENVGEEELKTIVT 66
BLAST of troponin i vs. nr
Match: gi|290462347|gb|ADD24221.1| (Troponin I [Lepeophtheirus salmonis]) HSP 1 Score: 88.5817 bits (218), Expect = 1.910e-17 Identity = 43/51 (84.31%), Postives = 49/51 (96.08%), Query Frame = 0 Query: 1 LRTLLRKKAAEELKKEQERKAAERQRVISERCGSKKDIENAGDEDLKKIIT 51 LRTLLRKKAAEELKKEQERKAAER+R+I+ERCGSKKDIEN G+E+LK I+T Sbjct: 16 LRTLLRKKAAEELKKEQERKAAERERIINERCGSKKDIENVGEEELKTIVT 66
BLAST of troponin i vs. nr
Match: gi|290463049|gb|ADD24572.1| (Troponin I [Lepeophtheirus salmonis]) HSP 1 Score: 87.8113 bits (216), Expect = 4.508e-17 Identity = 42/51 (82.35%), Postives = 49/51 (96.08%), Query Frame = 0 Query: 1 LRTLLRKKAAEELKKEQERKAAERQRVISERCGSKKDIENAGDEDLKKIIT 51 LRTLLRKKAAEELKKEQERKAAER+R+I+ERCGSKKDIEN G+E+L+ I+T Sbjct: 16 LRTLLRKKAAEELKKEQERKAAERERIINERCGSKKDIENVGEEELRTIVT 66
BLAST of troponin i vs. nr
Match: gi|339787925|gb|AEK11997.1| (putative troponin I, partial [Tigriopus californicus] >gi|339787927|gb|AEK11998.1| putative troponin I, partial [Tigriopus californicus] >gi|339787929|gb|AEK11999.1| putative troponin I, partial [Tigriopus californicus]) HSP 1 Score: 82.4185 bits (202), Expect = 2.285e-15 Identity = 41/44 (93.18%), Postives = 43/44 (97.73%), Query Frame = 0 Query: 7 KKAAEELKKEQERKAAERQRVISERCGSKKDIENAGDEDLKKII 50 KKAAEELKKEQERKAAERQRVISERCGSKKDIENA D+DLKKI+ Sbjct: 1 KKAAEELKKEQERKAAERQRVISERCGSKKDIENASDDDLKKIV 44
BLAST of troponin i vs. nr
Match: gi|509391696|gb|AGN29629.1| (troponin I [Acartia pacifica]) HSP 1 Score: 73.1738 bits (178), Expect = 3.135e-11 Identity = 38/49 (77.55%), Postives = 43/49 (87.76%), Query Frame = 0 Query: 1 LRTLLRKKAAEELKKEQERKAAERQRVISERCGSKKDIENAGDEDLKKI 49 LRTLLRKKAAEELKKEQERKA ER RVI+ERCG+K D E+A ++LKKI Sbjct: 16 LRTLLRKKAAEELKKEQERKAEERLRVIAERCGTKADFESANMDELKKI 64
BLAST of troponin i vs. nr
Match: gi|1325317153|ref|XP_023340314.1| (troponin I-like [Eurytemora affinis]) HSP 1 Score: 71.2478 bits (173), Expect = 3.475e-11 Identity = 38/49 (77.55%), Postives = 41/49 (83.67%), Query Frame = 0 Query: 1 LRTLLRKKAAEELKKEQERKAAERQRVISERCGSKKDIENAGDEDLKKI 49 LRTLLRKKAAEELKKEQERKA ER RVI+ERCGSK E + +DLKKI Sbjct: 16 LRTLLRKKAAEELKKEQERKAEERLRVIAERCGSKAQFEESSMDDLKKI 64
BLAST of troponin i vs. nr
Match: gi|1101337992|ref|XP_018917177.1| (PREDICTED: troponin I isoform X13 [Bemisia tabaci]) HSP 1 Score: 68.1662 bits (165), Expect = 1.293e-9 Identity = 33/44 (75.00%), Postives = 39/44 (88.64%), Query Frame = 0 Query: 9 AAEELKKEQERKAAERQRVISERCGSKKDIENAGDEDLKKIITT 52 AAEELKKEQERKAAER+R+I ERCGS KD++NA +E+LKKII Sbjct: 55 AAEELKKEQERKAAERRRIIEERCGSPKDLDNANEEELKKIIQQ 98
BLAST of troponin i vs. nr
Match: gi|1101337984|ref|XP_018917172.1| (PREDICTED: troponin I isoform X9 [Bemisia tabaci]) HSP 1 Score: 67.781 bits (164), Expect = 1.553e-9 Identity = 33/44 (75.00%), Postives = 39/44 (88.64%), Query Frame = 0 Query: 9 AAEELKKEQERKAAERQRVISERCGSKKDIENAGDEDLKKIITT 52 AAEELKKEQERKAAER+R+I ERCGS KD++NA +E+LKKII Sbjct: 61 AAEELKKEQERKAAERRRIIEERCGSPKDLDNANEEELKKIIQQ 104
BLAST of troponin i vs. nr
Match: gi|914566808|gb|KOB71297.1| (Troponin I transcript variant A [Operophtera brumata]) HSP 1 Score: 67.0106 bits (162), Expect = 1.648e-9 Identity = 35/48 (72.92%), Postives = 41/48 (85.42%), Query Frame = 0 Query: 4 LLRKKAAEELKKEQERKAAERQRVISERCGSKKDIENAGDEDLKKIIT 51 LLRKKAAEELKKEQERKAAER+R+I ERCG K+IE+A + LK+II Sbjct: 36 LLRKKAAEELKKEQERKAAERRRIIEERCGKPKNIEDANEAMLKRIIQ 83
BLAST of troponin i vs. nr
Match: gi|1101337994|ref|XP_018917178.1| (PREDICTED: troponin I isoform X14 [Bemisia tabaci]) HSP 1 Score: 67.3958 bits (163), Expect = 2.167e-9 Identity = 34/62 (54.84%), Postives = 45/62 (72.58%), Query Frame = 0 Query: 9 AAEELKKEQERKAAERQRVISERCGSKKDIENAGDEDLKKIITTTSGFSASHCFKIFDLSFL 70 AAEELKKEQERKAAER+R+I ERCGS KD++NA +E +KK+I+ + FDL ++ Sbjct: 55 AAEELKKEQERKAAERRRIIEERCGSPKDLDNANEEQVKKVISAYYDRICKLEDQKFDLEYV 116 The following BLAST results are available for this feature:
BLAST of troponin i vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 2
BLAST of troponin i vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 1
BLAST of troponin i vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold1743_size29358:3076..26218- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>snap_masked-scaffold1743_size29358-processed-gene-0.5 ID=snap_masked-scaffold1743_size29358-processed-gene-0.5|Name=troponin i|organism=Tigriopus kingsejongensis|type=gene|length=23143bp|location=Sequence derived from alignment at scaffold1743_size29358:3076..26218- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'troponin i' has the following synonyms
Add to Basket
|