uncharacterized protein LOC100162417, snap_masked-scaffold645_size120276-processed-gene-0.2 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of uncharacterized protein LOC100162417 vs. L. salmonis genes
Match: EMLSAG00000002424 (supercontig:LSalAtl2s:LSalAtl2s145:98262:104743:1 gene:EMLSAG00000002424 transcript:EMLSAT00000002424 description:"maker-LSalAtl2s145-augustus-gene-1.8") HSP 1 Score: 67.3958 bits (163), Expect = 1.164e-12 Identity = 41/142 (28.87%), Postives = 75/142 (52.82%), Query Frame = 0 Query: 13 WLEDSGAVQELRAQVRCRLIQGLRGRHRVSRPPTRAVGAPERALNHLVLEFLVNSGHWLSASVLASEAHFLSQLATESTDAPTQGGPSQPPALAKFPDSSLDLLFRWLRLPIPGASESLRTAYYREHRVSLLQVLLASLSSP 154 WL SG +QE ++++R LI+ + G++ + ++++N L++E+L+ +W SASVL SEA+FL Q + G ++ ++ + ++ + R+L L P S+RT Y + + SLL L +L P Sbjct: 552 WLTSSGKLQEFQSRLRTDLIEAIAGKNLRKKKKNIKESTFDQSVNSLIIEYLMIHSYWYSASVLVSEANFLVQ-PPDIEIVQKLGSETKRHTPSRISEEDINNILRFLNLD-PSIFNSIRTTYLNDSQESLLSATLINLKKP 691 The following BLAST results are available for this feature:
BLAST of uncharacterized protein LOC100162417 vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of uncharacterized protein LOC100162417 vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 0
BLAST of uncharacterized protein LOC100162417 vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold645_size120276:35670..36620+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>snap_masked-scaffold645_size120276-processed-gene-0.2 ID=snap_masked-scaffold645_size120276-processed-gene-0.2|Name=uncharacterized protein LOC100162417|organism=Tigriopus kingsejongensis|type=gene|length=951bp|location=Sequence derived from alignment at scaffold645_size120276:35670..36620+ (Tigriopus kingsejongensis)back to top Synonyms
The feature 'uncharacterized protein LOC100162417' has the following synonyms
Add to Basket
|