complexin, snap_masked-scaffold993_size72668-processed-gene-0.5 (gene) Tigriopus kingsejongensis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of complexin vs. L. salmonis genes
Match: EMLSAG00000001902 (supercontig:LSalAtl2s:LSalAtl2s1326:52134:55531:-1 gene:EMLSAG00000001902 transcript:EMLSAT00000001902 description:"maker-LSalAtl2s1326-snap-gene-0.18") HSP 1 Score: 71.2478 bits (173), Expect = 3.161e-17 Identity = 51/64 (79.69%), Postives = 54/64 (84.38%), Query Frame = 0 Query: 39 SYCNSIPGVGGGGGDDDEGESKEEQMEQERLRQEAIKQAERERRDKYKKQEDEREVMRQSIRDK 102 S +SIPGVG DDD GE+KEEQ EQERLRQEAIKQAERERRDKYKKQEDERE +RQ IRDK Sbjct: 7 SVTDSIPGVGSSSNDDD-GETKEEQEEQERLRQEAIKQAERERRDKYKKQEDERENLRQGIRDK 69
BLAST of complexin vs. SwissProt
Match: gi|5921801|sp|O42106.1|CPLX1_NARJA (RecName: Full=Complexin-1; AltName: Full=NJ-synaphin-2) HSP 1 Score: 48.9062 bits (115), Expect = 2.689e-7 Identity = 30/51 (58.82%), Postives = 36/51 (70.59%), Query Frame = 0 Query: 52 GDDDEGESKEEQMEQERLRQEAIKQAERERRDKYKKQEDEREVMRQSIRDK 102 G D+E + E+ E+ERL EA++QAE ER KY K E EREVMRQ IRDK Sbjct: 21 GGDEEKDPDAEKKEEERL--EALRQAEEERAGKYAKMEAEREVMRQGIRDK 69
BLAST of complexin vs. nr
Match: gi|1325268028|ref|XP_023344078.1| (complexin-like [Eurytemora affinis]) HSP 1 Score: 62.3882 bits (150), Expect = 4.134e-10 Identity = 35/60 (58.33%), Postives = 47/60 (78.33%), Query Frame = 0 Query: 43 SIPGVGGGGGDDDEGESKEEQMEQERLRQEAIKQAERERRDKYKKQEDEREVMRQSIRDK 102 S+P VGG DD G +KEEQ EQE++RQ+AIK+AERER++KYKK+ + R+V R IRD+ Sbjct: 15 SVPKVGGS--DDSNGMTKEEQKEQEQMRQDAIKRAERERQNKYKKEREVRDVERDKIRDR 72
BLAST of complexin vs. nr
Match: gi|1022767437|gb|KZS12268.1| (Complexin [Daphnia magna]) HSP 1 Score: 55.0694 bits (131), Expect = 1.179e-7 Identity = 34/73 (46.58%), Postives = 50/73 (68.49%), Query Frame = 0 Query: 30 FPPRYVEGTSYCNSIPGVGGGGGDDDEGESKEEQMEQERLRQEAIKQAERERRDKYKKQEDEREVMRQSIRDK 102 F + + G S N++ G+GG D ++G++K++ E ER R EAIK+AE R++K++K E ERE MRQ IRDK Sbjct: 4 FVAKQMLG-SKMNAVKGLGGN--DSEDGDTKDKDDEAERERLEAIKEAEDRRKEKHRKMEAERENMRQDIRDK 73
BLAST of complexin vs. nr
Match: gi|253683501|ref|NP_001156645.1| (complexin [Acyrthosiphon pisum] >gi|253683503|ref|NP_001156646.1| complexin [Acyrthosiphon pisum] >gi|985391609|ref|XP_015380520.1| PREDICTED: complexin isoform X1 [Diuraphis noxia] >gi|1229894369|ref|XP_022167716.1| complexin isoform X1 [Myzus persicae] >gi|239791501|dbj|BAH72206.1| ACYPI007078 [Acyrthosiphon pisum] >gi|239792042|dbj|BAH72407.1| ACYPI007078 [Acyrthosiphon pisum]) HSP 1 Score: 54.6842 bits (130), Expect = 4.589e-7 Identity = 34/73 (46.58%), Postives = 46/73 (63.01%), Query Frame = 0 Query: 30 FPPRYVEGTSYCNSIPGVGGGGGDDDEGESKEEQMEQERLRQEAIKQAERERRDKYKKQEDEREVMRQSIRDK 102 F + V G N++ G G GG+ E KE+ E ER R EAI++AE R++K++K E+ERE MRQ IRDK Sbjct: 4 FVAKQVVGNKL-NAVKGAVGDGGES--AEDKEKNAEAERERLEAIREAEERRKEKHRKMEEEREKMRQEIRDK 73
BLAST of complexin vs. nr
Match: gi|926651927|ref|XP_013792518.1| (complexin-like [Limulus polyphemus]) HSP 1 Score: 54.6842 bits (130), Expect = 6.292e-7 Identity = 34/65 (52.31%), Postives = 45/65 (69.23%), Query Frame = 0 Query: 38 TSYCNSIPGVGGGGGDDDEGESKEEQMEQERLRQEAIKQAERERRDKYKKQEDEREVMRQSIRDK 102 T C S G GG G+ E +S+ EQ EQERL EA+++AE R++K++K E+ERE MRQ IRDK Sbjct: 25 TLICWSSTGQMGGEGESQEDKSEAEQAEQERL--EALQEAEDRRKEKHRKLEEEREKMRQEIRDK 87
BLAST of complexin vs. nr
Match: gi|321477027|gb|EFX87986.1| (complexin [Daphnia pulex]) HSP 1 Score: 54.299 bits (129), Expect = 6.992e-7 Identity = 33/73 (45.21%), Postives = 50/73 (68.49%), Query Frame = 0 Query: 30 FPPRYVEGTSYCNSIPGVGGGGGDDDEGESKEEQMEQERLRQEAIKQAERERRDKYKKQEDEREVMRQSIRDK 102 F + + G S N++ G+GG +D + + K+++ E+ERL EAIK+AE R++K++K E ERE MRQ IRDK Sbjct: 4 FVAKQMLG-SKMNAVKGLGGNDSEDGDTKDKDDEAERERL--EAIKEAEDRRKEKHRKMEVERENMRQDIRDK 73 The following BLAST results are available for this feature:
BLAST of complexin vs. L. salmonis genes
Analysis Date: 2018-04-19 (T. kinsejongensis vs L. Salmonis peptides) Total hits: 1
BLAST of complexin vs. SwissProt
Analysis Date: 2018-04-19 (T. kingejongensis peptided Blastp vs. SwissProt) Total hits: 1
BLAST of complexin vs. nr
Analysis Date: 2018-05-15 (T. kingsejongensis proteins Blastp vs. NR) Total hits: 5
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at scaffold993_size72668:12610..16325- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>snap_masked-scaffold993_size72668-processed-gene-0.5 ID=snap_masked-scaffold993_size72668-processed-gene-0.5|Name=complexin|organism=Tigriopus kingsejongensis|type=gene|length=3716bp|location=Sequence derived from alignment at scaffold993_size72668:12610..16325- (Tigriopus kingsejongensis)back to top Synonyms
The feature 'complexin' has the following synonyms
Add to Basket
|