|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR007271 | Nucleotide-sugar transporter | PFAM | PF04142 | Nuc_sug_transp | coord: 95..401 e-value: 5.1E-122 score: 406.8 |
IPR007271 | Nucleotide-sugar transporter | PIRSF | PIRSF005799 | UDP-gal_transpt | coord: 82..416 e-value: 9.3E-118 score: 390.9 |
IPR007271 | Nucleotide-sugar transporter | PANTHER | PTHR10231 | NUCLEOTIDE-SUGAR TRANSMEMBRANE TRANSPORTER | coord: 94..409 |
None | No IPR available | TIGRFAM | TIGR00803 | TIGR00803 | coord: 177..400 e-value: 2.4E-60 score: 201.9 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 54..79 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 37..87 |
None | No IPR available | PANTHER | PTHR10231:SF36 | UDP-N-ACETYLGLUCOSAMINE TRANSPORTER | coord: 94..409 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 223..228 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 229..245 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 205..222 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 283..301 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 302..320 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 265..282 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 246..264 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 379..383 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 384..402 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 352..357 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 403..417 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 126..149 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 332..351 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 358..378 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 1..125 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 150..204 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 321..331 |
None | No IPR available | SUPERFAMILY | 103481 | Multidrug resistance efflux transporter EmrE | coord: 181..250 |
None | No IPR available | TMHMM | TMhelix | | coord: 229..246 |
None | No IPR available | TMHMM | TMhelix | | coord: 357..379 |
None | No IPR available | TMHMM | TMhelix | | coord: 331..350 |
None | No IPR available | TMHMM | TMhelix | | coord: 264..286 |
None | No IPR available | TMHMM | TMhelix | | coord: 383..402 |
None | No IPR available | TMHMM | TMhelix | | coord: 299..321 |
None | No IPR available | TMHMM | TMhelix | | coord: 200..222 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk02131 ID=Tk02131|Name=Tk02131|organism=Tigriopus kingsejongensis|type=polypeptide|length=417bp LILGSLCVAQSLVGVDPSDQLGPGDTFRADCRRQQVRVEAGRSDRPQAGS APSVMIRGSASGSDSLTQLHSTGQRPSGDAMSPTGVARAGPATNVNLKYL SLLTLTGQNAILGLSMRYSRTRPGELFFETTAVLMAEVVKLFTCLYLVFR DENHDVAQWKHTLYQTVVVNKIDTLKVCIPSAIYLVQNNLLYVAASNLDV ATYQITYQLKILTTAVFAVIMLNKKLIKIQWLSLLILILGVALVQTSDSK ESSTSIHEQSRVKGFASAITACVLSGLAGIYFEKILKGSDISVWMRNVQL SLLSIPLGVLVCLGKNYSGIFEKGFFHGYDAFVWYLVCLNATGGLLVAVV VKYADNILKGFACSLAIILTCVFSVIFFGFQLSIQFTLGAALVISSIFLY GYQPKKPTEGAGHSQKV back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR007271 | Nuc_sug_transpt |
Vocabulary: Molecular Function
Term | Definition |
GO:0015165 | pyrimidine nucleotide-sugar transmembrane transporter activity |
Vocabulary: Cellular Component
Term | Definition |
GO:0016021 | integral component of membrane |
GO:0000139 | Golgi membrane |
Vocabulary: Biological Process
Term | Definition |
GO:0090481 | pyrimidine nucleotide-sugar transmembrane transport |
|