|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| None | No IPR available | COILS | Coil | Coil | coord: 127..145 |
| None | No IPR available | PRINTS | PR00449 | RASTRNSFRMNG | coord: 53..75
score: 40.04
coord: 7..28
score: 42.49
coord: 116..129
score: 46.41
coord: 30..46
score: 30.43 |
| None | No IPR available | SMART | SM00173 | ras_sub_4 | coord: 4..145
e-value: 9.8E-7
score: -14.4 |
| None | No IPR available | SMART | SM00175 | rab_sub_5 | coord: 7..145
e-value: 2.9E-36
score: 136.5 |
| None | No IPR available | SMART | SM00174 | rho_sub_3 | coord: 9..145
e-value: 0.0014
score: -71.2 |
| None | No IPR available | GENE3D | 3.40.50.300 | | coord: 2..145
e-value: 2.8E-45
score: 156.1 |
| None | No IPR available | PANTHER | PTHR24073 | FAMILY NOT NAMED | coord: 7..144 |
| None | No IPR available | PANTHER | PTHR24073:SF511 | RAS-RELATED PROTEIN RAB-27A | coord: 7..144 |
| None | No IPR available | PROSITE | PS51419 | RAB | coord: 2..145
score: 23.558 |
| IPR005225 | Small GTP-binding protein domain | TIGRFAM | TIGR00231 | TIGR00231 | coord: 7..143
e-value: 4.2E-16
score: 57.1 |
| IPR001806 | Small GTPase superfamily | PFAM | PF00071 | Ras | coord: 8..144
e-value: 2.4E-40
score: 137.7 |
| IPR027417 | P-loop containing nucleoside triphosphate hydrolase | SUPERFAMILY | 52540 | P-loop containing nucleoside triphosphate hydrolases | coord: 3..144 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk03648 ID=Tk03648|Name=Tk03648|organism=Tigriopus kingsejongensis|type=polypeptide|length=145bp
MDYDYLLKFLILGNSGVGKTSFLYQFVDGEFSEKYITTVGVGFELPGIGH
SDRNIPLTPLAQQFWDTAGQERFRSLTTAFFRDAMGFILMFDLTNEQSFI
DVSNWMIQLQTHAYTETPDIILCGNKLDLEERRAVKKRDALDLAE back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|
