|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| None | No IPR available | PRINTS | PR00449 | RASTRNSFRMNG | coord: 182..204
score: 33.05
coord: 83..105
score: 39.86
coord: 147..160
score: 50.45
coord: 65..81
score: 26.21
coord: 42..63
score: 51.03 |
| None | No IPR available | SMART | SM00175 | rab_sub_5 | coord: 42..204
e-value: 5.2E-66
score: 235.3 |
| None | No IPR available | SMART | SM00173 | ras_sub_4 | coord: 39..205
e-value: 2.4E-16
score: 70.3 |
| None | No IPR available | SMART | SM00174 | rho_sub_3 | coord: 44..203
e-value: 1.5E-11
score: 28.4 |
| None | No IPR available | GENE3D | 3.40.50.300 | | coord: 13..204
e-value: 9.2E-59
score: 199.9 |
| None | No IPR available | PANTHER | PTHR24073:SF666 | RAS-RELATED PROTEIN RABD2B-RELATED | coord: 41..200 |
| None | No IPR available | PANTHER | PTHR24073 | FAMILY NOT NAMED | coord: 41..200 |
| None | No IPR available | PROSITE | PS51419 | RAB | coord: 27..205
score: 26.941 |
| None | No IPR available | CDD | cd00154 | Rab | coord: 42..202
e-value: 3.12854E-71
score: 211.546 |
| IPR001806 | Small GTPase superfamily | PFAM | PF00071 | Ras | coord: 43..202
e-value: 3.0E-50
score: 169.9 |
| IPR005225 | Small GTP-binding protein domain | TIGRFAM | TIGR00231 | TIGR00231 | coord: 41..199
e-value: 3.9E-31
score: 106.0 |
| IPR027417 | P-loop containing nucleoside triphosphate hydrolase | SUPERFAMILY | 52540 | P-loop containing nucleoside triphosphate hydrolases | coord: 40..203 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk04999 ID=Tk04999|Name=Tk04999|organism=Tigriopus kingsejongensis|type=polypeptide|length=205bp
LISLVSGQRASIVDRRTMSFKGLTSSSYEKRAERQKSLEASFKLVMIGDS
GVGKSCLLEKLLDLSSTNAFISTIGVDVRTHVINVNGHAFKLQVWDTGGQ
QRYRPVLASCYRNVHGIIMVFDVTNPKSFANLPQWIKEVKEFTPNQSGVP
KLLIGNKSDLADRRVISHEQAEAFAKENSMSYIETSAIATKNIREAFMTL
LQHKP back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|
