|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 16..38 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_N_REGION | Signal peptide N-region | coord: 1..2 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_H_REGION | Signal peptide H-region | coord: 3..10 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_C_REGION | Signal peptide C-region | coord: 11..15 |
| None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 39..56 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE | Signal Peptide | coord: 1..15 |
| None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 57..152 |
| None | No IPR available | SIGNALP_EUK | SignalP-TM | SignalP-TM | coord: 1..15
score: 0.816 |
| None | No IPR available | SIGNALP_GRAM_POSITIVE | SignalP-TM | SignalP-TM | coord: 1..23
score: 0.483 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk05133 ID=Tk05133|Name=Tk05133|organism=Tigriopus kingsejongensis|type=polypeptide|length=152bp
MQAVLILACLAVASAIPHFPANGVETSDLLLAEFEEYVPFVLILACLAVA
SAMPHFPANGVESSDLPLAEFEEYVPYVSNGVANVERSKRSAEPFFFNFG
RNNRRHGYGYGHNHHGYGGGYHNHRHYNHGYGGGYNNYGRRNHGYGHYHG
YH back to top
|
