|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR000618 | Insect cuticle protein | PFAM | PF00379 | Chitin_bind_4 | coord: 45..98
e-value: 2.2E-7
score: 31.2 |
| IPR000618 | Insect cuticle protein | PROSITE | PS51155 | CHIT_BIND_RR_2 | coord: 42..115
score: 11.216 |
| None | No IPR available | PANTHER | PTHR12236 | STRUCTURAL CONTITUENT OF CUTICLE | coord: 36..112 |
| None | No IPR available | PANTHER | PTHR12236:SF67 | SUBFAMILY NOT NAMED | coord: 36..112 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_C_REGION | Signal peptide C-region | coord: 16..19 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_H_REGION | Signal peptide H-region | coord: 8..15 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE | Signal Peptide | coord: 1..19 |
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 20..137 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_N_REGION | Signal peptide N-region | coord: 1..7 |
| None | No IPR available | SIGNALP_EUK | SignalP-noTM | SignalP-noTM | coord: 1..19
score: 0.597 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk07914 ID=Tk07914|Name=Tk07914|organism=Tigriopus kingsejongensis|type=polypeptide|length=137bp
MEKSYRHLLLHSLLAGVEAAGLEYSKTPTTWRSYGHFAQGQYTLYNYAYA
VHDDYSGANFGQEEKRDGYATSGQYHVALPDGRIQTVTYSVADEYSGYVA
DVSYSGKATYGPGPHKARMLASMTTWQHPATVLVEYK back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
| Term | Definition |
|---|
| IPR000618 | Insect_cuticle |
Vocabulary: Molecular Function
| Term | Definition |
|---|
| GO:0042302 | structural constituent of cuticle |
|
