|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR014001 | Helicase superfamily 1/2, ATP-binding domain | SMART | SM00487 | ultradead3 | coord: 6..155
e-value: 0.0067
score: 17.6 |
| IPR014001 | Helicase superfamily 1/2, ATP-binding domain | PROSITE | PS51192 | HELICASE_ATP_BIND_1 | coord: 18..155
score: 13.967 |
| IPR011545 | DEAD/DEAH box helicase domain | PFAM | PF00270 | DEAD | coord: 60..95
e-value: 1.0E-6
score: 28.6
coord: 13..47
e-value: 9.7E-7
score: 28.6 |
| None | No IPR available | GENE3D | 3.40.50.300 | | coord: 96..155
e-value: 6.1E-24
score: 86.3 |
| None | No IPR available | GENE3D | 3.40.50.300 | | coord: 49..95
e-value: 2.4E-17
score: 64.8
coord: 1..48
e-value: 1.2E-17
score: 65.7 |
| None | No IPR available | PANTHER | PTHR13710 | DNA HELICASE RECQ FAMILY MEMBER | coord: 97..154 |
| None | No IPR available | PANTHER | PTHR13710:SF105 | BLOOM SYNDROME PROTEIN | coord: 97..154 |
| None | No IPR available | PANTHER | PTHR13710 | DNA HELICASE RECQ FAMILY MEMBER | coord: 50..93
coord: 2..46 |
| None | No IPR available | PANTHER | PTHR13710:SF105 | BLOOM SYNDROME PROTEIN | coord: 50..93
coord: 2..46 |
| None | No IPR available | CDD | cd00046 | DEXDc | coord: 25..137
e-value: 3.52159E-6
score: 41.9392 |
| IPR027417 | P-loop containing nucleoside triphosphate hydrolase | SUPERFAMILY | 52540 | P-loop containing nucleoside triphosphate hydrolases | coord: 52..150 |
| IPR027417 | P-loop containing nucleoside triphosphate hydrolase | SUPERFAMILY | 52540 | P-loop containing nucleoside triphosphate hydrolases | coord: 1..47 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk10666 ID=Tk10666|Name=Tk10666|organism=Tigriopus kingsejongensis|type=polypeptide|length=155bp
LKDIFGFDNFRGTQEEIITSIASGKNTFVIMPTGAGKSLCYQLPAISTSD
IFGFDNFRGTQEEIITSIASGKNTFVIMPTGAGKSLCYQLPAISTSAVDE
AHCISEWGHDFRPEYRKIRSIIESINIDLPIIALTATATPKVQQDIQKNL
NMDDS back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|
