|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR018108 | Mitochondrial substrate/solute carrier | PFAM | PF00153 | Mito_carr | coord: 12..97
e-value: 3.3E-15
score: 55.7 |
| IPR018108 | Mitochondrial substrate/solute carrier | PROSITE | PS50920 | SOLCAR | coord: 9..94
score: 17.128 |
| IPR023395 | Mitochondrial carrier domain superfamily | GENE3D | 1.50.40.10 | | coord: 3..159
e-value: 6.1E-26
score: 92.8 |
| IPR023395 | Mitochondrial carrier domain superfamily | SUPERFAMILY | 103506 | Mitochondrial carrier | coord: 10..142 |
| None | No IPR available | PANTHER | PTHR24089 | FAMILY NOT NAMED | coord: 11..140 |
| None | No IPR available | PANTHER | PTHR24089:SF256 | SUBFAMILY NOT NAMED | coord: 11..140 |
| None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 66..88 |
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 89..107 |
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 1..11 |
| None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 12..32 |
| None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 33..65 |
| None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 108..128 |
| None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 129..164 |
| None | No IPR available | TMHMM | TMhelix | | coord: 66..88 |
| None | No IPR available | TMHMM | TMhelix | | coord: 108..130 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk11203 ID=Tk11203|Name=Tk11203|organism=Tigriopus kingsejongensis|type=polypeptide|length=164bp
MSGLSLISYESLVHAISGACGSGSAMAVTLPLDTIRTRLLLDPGQSRRGS
WQMLGRIVHEEGVLSLYYGAQSTILCVMVSNFVYFYAFHGLKQMLVGKAS
AQTAAKDLLLACLAGCVNVGLTNPLWVVNSQLKMQGQSRRSKVNEGTTHP
RLRFRGLFGIATNS back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
| Term | Definition |
|---|
| IPR018108 | Mitochondrial_sb/sol_carrier |
| IPR023395 | Mt_carrier_dom_sf |
|
