|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR003591 | Leucine-rich repeat, typical subtype | SMART | SM00369 | LRR_typ_2 | coord: 481..504 e-value: 4.5 score: 16.1 coord: 457..480 e-value: 48.0 score: 7.7 coord: 410..432 e-value: 2.6 score: 17.0 coord: 317..339 e-value: 10.0 score: 13.2 coord: 575..597 e-value: 0.99 score: 18.4 coord: 340..362 e-value: 8.0 score: 14.0 coord: 386..409 e-value: 0.024 score: 23.8 coord: 363..385 e-value: 43.0 score: 8.1 coord: 271..293 e-value: 5.3 score: 15.6 coord: 644..667 e-value: 0.27 score: 20.3 coord: 621..643 e-value: 2.9 score: 16.9 coord: 598..620 e-value: 22.0 score: 10.4 coord: 531..552 e-value: 250.0 score: 1.8 coord: 294..316 e-value: 2.5 score: 17.1 |
None | No IPR available | SMART | SM00364 | LRR_bac_2 | coord: 621..640 e-value: 98.0 score: 6.2 coord: 644..663 e-value: 30.0 score: 10.0 coord: 575..594 e-value: 38.0 score: 9.3 coord: 409..428 e-value: 29.0 score: 10.2 coord: 481..500 e-value: 600.0 score: 0.2 coord: 294..313 e-value: 11.0 score: 13.5 coord: 667..688 e-value: 220.0 score: 3.5 coord: 529..548 e-value: 340.0 score: 2.0 coord: 363..382 e-value: 62.0 score: 7.7 coord: 598..617 e-value: 500.0 score: 0.8 coord: 457..476 e-value: 41.0 score: 9.1 coord: 271..290 e-value: 47.0 score: 8.6 |
None | No IPR available | SMART | SM00365 | LRR_sd22_2 | coord: 575..597 e-value: 180.0 score: 5.4 coord: 644..672 e-value: 170.0 score: 5.4 coord: 271..292 e-value: 110.0 score: 7.2 coord: 294..316 e-value: 380.0 score: 2.7 coord: 340..365 e-value: 24.0 score: 12.5 coord: 386..401 e-value: 750.0 score: 0.3 coord: 409..434 e-value: 300.0 score: 3.5 coord: 598..616 e-value: 250.0 score: 4.2 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 121..135 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 93..137 |
None | No IPR available | PANTHER | PTHR44179 | FAMILY NOT NAMED | coord: 208..722 |
None | No IPR available | PANTHER | PTHR44179:SF2 | LEUCINE-RICH REPEAT PROTEIN SHOC-2 | coord: 208..722 |
None | No IPR available | SUPERFAMILY | 52047 | RNI-like | coord: 480..714 |
None | No IPR available | SUPERFAMILY | 52058 | L domain-like | coord: 249..522 |
IPR001611 | Leucine-rich repeat | PFAM | PF13855 | LRR_8 | coord: 342..399 e-value: 1.6E-7 score: 30.9 coord: 622..678 e-value: 1.1E-9 score: 37.9 coord: 292..330 e-value: 1.0E-8 score: 34.7 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 434..454 score: 4.601 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 296..318 score: 7.997 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 554..575 score: 5.779 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 483..504 score: 5.841 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 388..409 score: 6.31 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 669..691 score: 5.895 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 273..294 score: 5.255 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 646..667 score: 5.794 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 319..340 score: 7.404 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 365..386 score: 6.38 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 531..552 score: 5.794 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 459..480 score: 5.771 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 623..644 score: 6.488 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 577..598 score: 7.704 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 411..432 score: 8.143 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 342..363 score: 7.08 |
IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 600..621 score: 7.165 |
IPR032675 | Leucine-rich repeat domain superfamily | GENE3D | 3.80.10.10 | | coord: 403..500 e-value: 6.8E-24 score: 86.1 coord: 502..609 e-value: 4.1E-24 score: 86.8 coord: 610..714 e-value: 6.7E-25 score: 89.4 |
IPR032675 | Leucine-rich repeat domain superfamily | GENE3D | 3.80.10.10 | | coord: 183..402 e-value: 2.7E-45 score: 156.2 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk11323 ID=Tk11323|Name=Tk11323|organism=Tigriopus kingsejongensis|type=polypeptide|length=810bp RPIGQASASRSPRKPTLGHARPSAKARGPDRVSEPARLRASRETRATFRA AAASPLTRIPGRTCRRAGGRDRALAARIDPAWLRGPECAPLRPWAPASLS PERPAARSRSLMKRANRPKNLSGGAGQQSSGEGETAAELHQRALAGVSHY ADQIPDSPDYNAAAETVSIASTMPELQSSTDASMASLTSSFKDMMKKEKK NAIYDTSDAKKVTVEIDGKKKRTGGQNSKKSVVTTNLDLPREFAKCKEEN KTRLDLAKSNISHVPASIKELTQLKELYVYSNRLAILPNEVGGLANLTTL SLSENVLTSLPDSLANLRQLRVLDLRHNRFPEIPPVVYTLTSLTTLYLRF NRIKEVGNEIGNLSRLANLSIRENNITSLPPSVGNLTRLVTFDMSYNQLE TIPPEIGECTQLTTLDLQHNKLASLPDSIGNLVYLTRLGLRYNRLSFSSI PCSLAKCNALEQFNVENNLISSLPEGLLSSLENLTQISLSRNQFSNFPPG GPAQFINTVVLNMEHNQCDRIPYGIFSRANHLQKLNMKENMLTSLPIDIG TWHSVVELNFGTNQIQKLPDDIACLANLEVLVLSNNLLRKLPSNIGQLQK LRILELEENKLDNIPNEIGRLRELQKLILQSNNLTQLPRAIGQLSKLEYL SVGENLLSFLPEEIGSLESLESLYINDNPHLQSLPFELALCSKLEIMSIE NCPLNRIPGEIVAGGPSLVIQSYQDWEASPSNAHKATHVALNDVARTITG KSRQDHVQIADLLHLVGLPSFNELAVRALVMETWKAFRSSDGKHGGRNIL GKIIFPSPRR back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
Term | Definition |
GO:0005515 | protein binding |
|