|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR001564 | Nucleoside diphosphate kinase | PRINTS | PR01243 | NUCDPKINASE | coord: 52..68 score: 67.55 coord: 75..94 score: 55.08 coord: 11..30 score: 43.23 coord: 31..48 score: 46.06 |
IPR034907 | Nucleoside diphosphate kinase-like domain | SMART | SM00562 | ndk_5 | coord: 1..101 e-value: 4.0E-43 score: 159.3 |
IPR034907 | Nucleoside diphosphate kinase-like domain | PFAM | PF00334 | NDK | coord: 1..97 e-value: 8.0E-38 score: 129.4 |
IPR036850 | Nucleoside diphosphate kinase-like domain superfamily | GENE3D | 3.30.70.141 | | coord: 1..104 e-value: 1.7E-40 score: 140.1 |
IPR036850 | Nucleoside diphosphate kinase-like domain superfamily | SUPERFAMILY | 54919 | Nucleoside diphosphate kinase, NDK | coord: 1..101 |
None | No IPR available | PANTHER | PTHR11349 | NUCLEOSIDE DIPHOSPHATE KINASE | coord: 1..97 |
None | No IPR available | CDD | cd04413 | NDPk_I | coord: 1..94 e-value: 2.23244E-57 score: 171.112 |
IPR023005 | Nucleoside diphosphate kinase, active site | PROSITE | PS00469 | NDP_KINASES | coord: 75..83 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk11412 ID=Tk11412|Name=Tk11412|organism=Tigriopus kingsejongensis|type=polypeptide|length=104bp MHLTQEQAEGFYAVHAERPFYKDLVAFMRSGPVMVQVLEGENAIAKHRDV MGATNPAEAAAGTIRADFASSIDENACHGSDAPETAAQEIAFFFGEEGVC PRTR back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
Term | Definition |
GO:0004550 | nucleoside diphosphate kinase activity |
|