|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR023352 | Membrane associated eicosanoid/glutathione metabolism-like domain superfamily | GENE3D | 1.20.120.550 | | coord: 7..151
e-value: 5.6E-56
score: 190.6 |
| IPR023352 | Membrane associated eicosanoid/glutathione metabolism-like domain superfamily | SUPERFAMILY | 161084 | MAPEG domain-like | coord: 18..147 |
| IPR001129 | Membrane-associated, eicosanoid/glutathione metabolism (MAPEG) protein | PFAM | PF01124 | MAPEG | coord: 21..149
e-value: 6.7E-28
score: 97.1 |
| None | No IPR available | PANTHER | PTHR10689 | MICROSOMAL GLUTATHIONE S-TRANSFERASE 1 | coord: 10..150 |
| None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 80..96 |
| None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 20..39 |
| None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 131..151 |
| None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 102..122 |
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 152..152 |
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 1..19 |
| None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 123..130 |
| None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 40..79 |
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 97..101 |
| None | No IPR available | TMHMM | TMhelix | | coord: 83..105 |
| None | No IPR available | TMHMM | TMhelix | | coord: 131..150 |
| None | No IPR available | TMHMM | TMhelix | | coord: 20..39 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk11737 ID=Tk11737|Name=Tk11737|organism=Tigriopus kingsejongensis|type=polypeptide|length=152bp
LLCQSHTIKMEVNGDLAKSFAFYATLLVAKVLIMAFLTARQRFAKNVFAN
KEDAAKSAKAKVNFQDDDVERVRRAHQNDIENIFPFLFLGAVYLLTDPSE
YVAMMCFRVFTAARFIHTFVYLKQVPQPSRALAFFVGMGVNFYMVFCILT
GL back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|
