|
Associated RNAi Experiments
InterPro
Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR038456 | Macin superfamily | GENE3D | 3.30.30.100 | | coord: 27..85 e-value: 7.9E-22 score: 79.2 |
IPR029230 | Macin | PFAM | PF14865 | Macin | coord: 30..84 e-value: 3.0E-7 score: 30.8 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE | Signal Peptide | coord: 1..25 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_H_REGION | Signal peptide H-region | coord: 4..17 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_C_REGION | Signal peptide C-region | coord: 18..25 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 26..98 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_N_REGION | Signal peptide N-region | coord: 1..3 |
None | No IPR available | SIGNALP_GRAM_NEGATIVE | SignalP-noTM | SignalP-noTM | coord: 1..25 score: 0.727 |
None | No IPR available | SIGNALP_EUK | SignalP-noTM | SignalP-noTM | coord: 1..25 score: 0.87 |
None | No IPR available | SIGNALP_GRAM_POSITIVE | SignalP-TM | SignalP-TM | coord: 1..25 score: 0.804 |
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Tk11840 ID=Tk11840|Name=Tk11840|organism=Tigriopus kingsejongensis|type=polypeptide|length=98bp MKSLILSLSLLVVLVSLTQVQEAEAGWGDCWETWSRCTRWSSAGTGYLWQ SCAQRCQCLGKASGSCVMSRSSCPLSNKAWQCRCSGTRRGPKPRWCGF back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
Term | Definition |
GO:0006952 | defense response |
|