Tk12235, Tk12235 (polypeptide) Tigriopus kingsejongensis

Overview


Name	Tk12235
Unique Name	Tk12235
Type	polypeptide
Organism	Tigriopus kingsejongensis (Tigriopus kingsejongensis)
Sequence length	157

Associated RNAi Experiments

Nothing found

InterPro

Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
IPR013680	Voltage-dependent calcium channel, alpha-2/delta subunit, conserved region	PFAM	PF08473	VGCC_alpha2	coord: 49..126 e-value: 1.7E-9 score: 36.9
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 157..157
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 1..131
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 132..156
None	No IPR available	TMHMM	TMhelix		coord: 134..156

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
Tigriopus kinsejongensis Genome annotation	2018-02-12
InterProScan T. kingsejongensis	2018-08-30

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type
maker-scaffold87_size395581-snap-gene-0.15-mRNA-1	maker-scaffold87_size395581-snap-gene-0.15-mRNA-1	Tigriopus kingsejongensis	mRNA

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>Tk12235 ID=Tk12235|Name=Tk12235|organism=Tigriopus kingsejongensis|type=polypeptide|length=157bp
LALLFLPESSMSVSEYSFRMPEGMHRCTTNTSYWSLNPELKSDDFHERIS
GDCKECSRDYHIYKLSQINALLIVSDPKCISCNVPSYKDKPIEVDPEALE
TCHLPKRFRKRPPKCFSRHEEEIPECSSASPLFFPFQLLKLSMALIPILV
SVVLVVD

Annotated Terms

The following terms have been associated with this polypeptide:

Vocabulary: **INTERPRO**
Term	Definition
IPR013680	VDCC_a2/dsu

Add to Basket

Search form