Tk12437, Tk12437 (polypeptide) Tigriopus kingsejongensis

Overview


Name	Tk12437
Unique Name	Tk12437
Type	polypeptide
Organism	Tigriopus kingsejongensis (Tigriopus kingsejongensis)
Sequence length	129

Associated RNAi Experiments

Nothing found

InterPro

Analysis Name: InterProScan T. kingsejongensis
Date Performed: 2018-08-30


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 94..129
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 89..129
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 1..20
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 21..41
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 67..88
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 42..66
None	No IPR available	TMHMM	TMhelix		coord: 67..89
None	No IPR available	TMHMM	TMhelix		coord: 21..40

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
Tigriopus kinsejongensis Genome annotation	2018-02-12
InterProScan T. kingsejongensis	2018-08-30

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type
maker-scaffold602_size127160-snap-gene-0.26-mRNA-1	maker-scaffold602_size127160-snap-gene-0.26-mRNA-1	Tigriopus kingsejongensis	mRNA

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>Tk12437 ID=Tk12437|Name=Tk12437|organism=Tigriopus kingsejongensis|type=polypeptide|length=129bp
MNEYNKDNDGNYDYRYTIWNLCWINLRILSILLSAVALVLAEPEPFLFSK
RGGRGESHQFSIDRVEIIIMSKLIILSILLSAVALVLAEPEPFLFSKRGG
RGGGHGGRGGRGGRGGHGSRGGYGKREAE

Add to Basket

Search form